You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) IL2 antibody for Immunocytochemistry

Recommended IL2 Antibody (supplied by: Log in to see )

Antigen
Interleukin 2 (IL2) Antibodies
  • Il-2
  • IL-2
  • IL2
  • il2
  • lymphokine
  • POIL2
  • TCGF
Epitope
AA 31-251
17
17
14
13
13
10
6
5
4
4
3
2
2
2
2
2
1
1
1
1
1
Reactivity
Rat (Rattus)
372
219
88
18
13
7
6
4
4
3
2
2
1
1
Host
Rabbit
255
207
193
17
7
4
Clonality
Polyclonal
Conjugate
This IL2 antibody is un-conjugated
87
45
43
21
21
12
7
6
6
5
4
4
4
4
4
4
3
3
2
2
2
2
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
361
323
153
68
60
44
43
38
32
30
20
16
15
10
9
8
7
6
6
4
4
3
2
2
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN1172186
$ 266.20
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0009952392 ABIN1172189 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal

Similar anti-IL2 Antibodies

Application / Reactivity Rat (Rattus)
Blocking Antibody (Inhibition) 2 Antibodies
Blocking Peptide (BP) 1 Antibodies
Dot Blot (DB) 2 Antibodies
ELISA 46 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Functional Studies (Func) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 22 Antibodies
Immunohistochemistry (IHC) 5 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Neutralization (Neut) 9 Antibodies
Western Blotting (WB) 55 Antibodies

General

Antigen Interleukin 2 (IL2) Antibodies
Epitope AA 31-251
(17), (17), (14), (13), (13), (10), (6), (5), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Rat (Rattus)
(372), (219), (88), (18), (13), (7), (6), (4), (4), (3), (2), (2), (1), (1)
Host Rabbit
(255), (207), (193), (17), (7), (4)
Clonality
Polyclonal
Conjugate This IL2 antibody is un-conjugated
(87), (45), (43), (21), (21), (12), (7), (6), (6), (5), (4), (4), (4), (4), (4), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(361), (323), (153), (68), (60), (44), (43), (38), (32), (30), (20), (16), (15), (10), (9), (8), (7), (6), (6), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL2 Antibody

Target Details IL2 Application Details Handling Images
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-MELHVPPGLN KLEAVEGEEV VLPAWYTMAR EESSSHPWEA PFLIWFLEQE GKEPKQVLSY FKGSLSNKPG VTLVHSISTR NVSLRLDALQ EGDSGTYRCS VNAYDSDGKN IGHSIKTIEL KVLVPPAPPS CSFQGVPYVG TNVTLNCKSP RSKPTAQYQW ERLAPSSQVF FGPALDTVRG SLKLTNISTA MSGVYVCKAQ NRVGFAQCNV TLDVMTGSKA A
Specificity It has been selected for its ability to recognize IL2 in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant ESAM expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against IL2.
Isotype IgG

Target Details IL2

Product Details anti-IL2 Antibody Application Details Handling Images back to top
Antigen
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL2 Antibody Target Details IL2 Handling Images back to top
Comment

Content: The quality control contains recombinant ESAM (Met31~Ala251) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions For Research Use only

Handling

Product Details anti-IL2 Antibody Target Details IL2 Application Details Images back to top
Format Lyophilized
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3,50 % glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months