anti-Mouse (Murine) IL21 antibody for Immunohistochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Epitope
N-Term
23
18
15
13
7
7
6
6
6
6
3
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
204
102
24
10
5
5
4
1
1
Host
Goat
166
70
41
10
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
20
15
11
10
9
8
6
6
5
5
5
5
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
ELISA, Immunohistochemistry (IHC)
187
132
49
38
34
26
15
13
7
6
5
4
4
4
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN152155
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.343454 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Log in to see Polyclonal
1 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Log in to see Polyclonal 5
1 ABIN342766 IHC ELISA Goat AA 33-61 Log in to see Polyclonal
1 ABIN342765 IHC ELISA Rabbit AA 118-146 Log in to see Polyclonal
1 ABIN1868626 ICC IHC IP WB Rabbit IgG AA 25-146 Log in to see Polyclonal
1 ABIN2883051 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2935467 ELISA IF/ICC IHC WB Rabbit AA 25-146 Log in to see Polyclonal

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(23), (18), (15), (13), (7), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(204), (102), (24), (10), (5), (5), (4), (1), (1)
Host Goat
(166), (70), (41), (10), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(20), (15), (11), (10), (9), (8), (6), (6), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application ELISA, Immunohistochemistry (IHC)
(187), (132), (49), (38), (34), (26), (15), (13), (7), (6), (5), (4), (4), (4), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
Purification Immunogen affinity purified
Immunogen Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21.

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 (IL21 Antibody Abstract)
Background Gene Symbol: IL21
Gene ID 59067
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes ELISA 1:100-1:2000, Immunohistochemistry 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4, 0.14M NaCl and 1.0 mg/mL BSA
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 21 (IL21) (N-Term) antibody (ABIN152155) Immunohistochemistry with goat antibody N-terminus of mouse IL-21.