You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 antibody for Immunohistochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • interleukin 21-like
  • IL21
  • Il21
  • LOC100344172
Epitope
N-Term
23
17
15
13
8
7
6
6
6
6
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
198
97
24
7
5
5
2
1
1
Host
Goat
157
68
36
10
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
17
15
10
9
9
8
6
6
5
5
5
5
3
3
3
3
3
3
3
3
2
2
1
1
1
1
1
1
Application
ELISA, Immunohistochemistry (IHC)
176
124
46
38
32
25
14
13
7
6
5
4
4
4
3
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN152155
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.2386675 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Log in to see Polyclonal
1 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Log in to see Polyclonal 5
1 ABIN342766 IHC ELISA Goat AA 33-61 Log in to see Polyclonal
1 ABIN342765 IHC ELISA Rabbit AA 118-146 Log in to see Polyclonal
1 ABIN1868626 ICC IHC IP WB Rabbit IgG AA 25-146 Log in to see Polyclonal
1 ABIN2883051 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2935467 ELISA IF/ICC IHC WB Rabbit AA 25-146 Log in to see Polyclonal

Top referenced anti-IL21 antibody for Immunohistochemistry

  • Human Polyclonal IL21 Primary Antibody for ICC, IF - ABIN315232 (5 Publications): Liu, Xia, Wu, Wu, Tang, Chen, Xu, Cong, Xu, Liu: Anti-tumour necrosis factor therapy enhances mucosal healing through down-regulation of interleukin-21 expression and T helper type 17 cell infiltration in Crohn's disease. in Clinical and experimental immunology 2013 (PubMed)

Similar anti-IL21 Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 1 Antibodies
ELISA 38 Antibodies
Flow Cytometry (FACS) 36 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Intracellular Flow Cytometry (ICFC) 3 Antibodies
Western Blotting (WB) 46 Antibodies

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(23), (17), (15), (13), (8), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(198), (97), (24), (7), (5), (5), (2), (1), (1)
Host Goat
(157), (68), (36), (10), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(17), (15), (10), (9), (9), (8), (6), (6), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Application ELISA, Immunohistochemistry (IHC)
(176), (124), (46), (38), (32), (25), (14), (13), (7), (6), (5), (4), (4), (4), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
Purification Immunogen affinity purified
Immunogen Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21.

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 (IL21 Antibody Abstract)
Background Gene Symbol: IL21
Gene ID 59067
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes ELISA 1:100-1:2000, Immunohistochemistry 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4, 0.14M NaCl and 1.0 mg/mL BSA
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 antibody (Interleukin 21) (N-Term) (ABIN152155) Immunohistochemistry with goat antibody N-terminus of mouse IL-21.