You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 antibody for Immunohistochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • interleukin 21-like
  • IL21
  • Il21
  • LOC100344172
Mouse (Murine)
This IL21 antibody is un-conjugated
ELISA, Immunohistochemistry (IHC)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN152155
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.693808 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Log in to see Polyclonal
8.693808 ABIN2490863 IHC ELISA WB Rabbit AA 97-111 Log in to see Polyclonal
1 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Log in to see Polyclonal 4
1 ABIN342766 IHC ELISA Goat N-Term Log in to see Polyclonal
1 ABIN342765 IHC ELISA Rabbit C-Term Log in to see Polyclonal

Top referenced anti-IL21 antibody for Immunohistochemistry

  • Human Polyclonal IL21 Primary Antibody for ICC, IF - ABIN315232 (4 Publications): Liu, Xia, Wu, Wu, Tang, Chen, Xu, Cong, Xu, Liu: Anti-tumour necrosis factor therapy enhances mucosal healing through down-regulation of interleukin-21 expression and T helper type 17 cell infiltration in Crohn's disease. in Clinical and experimental immunology 2013 (PubMed)

Similar anti-IL21 Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 40 Antibodies
Flow Cytometry (FACS) 30 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 6 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Intracellular Flow Cytometry (ICFC) 3 Antibodies
Western Blotting (WB) 46 Antibodies


Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(26), (18), (14), (13), (11), (8), (8), (6), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(202), (89), (22), (8), (5), (5)
Host Goat
(162), (66), (30), (11), (5)
Conjugate This IL21 antibody is un-conjugated
(19), (15), (9), (8), (8), (8), (6), (6), (5), (5), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application ELISA, Immunohistochemistry (IHC)
(181), (128), (41), (33), (32), (25), (15), (11), (7), (6), (6), (4), (3), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
Cross-Reactivity (Details) Expected to cross-react with rat,(93% identity with immunogen) due to sequence homology.
Purification Immunogen affinity purified
Immunogen Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21.

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Alternative Name IL-21 (IL21 Antibody Abstract)
Background Gene Symbol: IL21
Gene ID 59067
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes ELISA 1:100-1:2000, Immunohistochemistry 1:500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4, 0.14M NaCl and 1.0 mg/mL BSA
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 antibody (Interleukin 21) (N-Term) (ABIN152155) Immunohistochemistry with goat antibody N-terminus of mouse IL-21.