You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 Receptor antibody for Immunohistochemistry

Recommended IL21 Receptor Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 Receptor (IL21R) Antibodies
  • CD360
  • il-21ra.a
  • IL21R
  • NILR
Epitope
N-Term, AA 35-65
13
13
11
8
7
4
4
2
2
1
1
1
Reactivity
Mouse (Murine)
92
50
30
2
Host
Rabbit
71
22
15
6
Clonality
Polyclonal
Conjugate
This IL21 Receptor antibody is un-conjugated
8
6
6
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
52
38
29
21
13
11
4
4
2
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN152158
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.2292046 ABIN2421119 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.2292046 ABIN2427703 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.0011344266 ABIN1002623 IHC ELISA WB Rabbit IgG Extracellular Domain Log in to see Polyclonal 4
0.0011344266 ABIN342780 FACS IHC ELISA Rabbit N-Term Log in to see Polyclonal
0.0011344266 ABIN1905061 FACS IHC ELISA Rabbit N-Term Log in to see Polyclonal
0.0011344266 ABIN1886904 IHC ELISA WB Rabbit AA 97-111 Log in to see Polyclonal
0.0011344266 ABIN2288646 IHC ELISA Rabbit IgG AA 35-46 Log in to see Polyclonal
0.0011344266 ABIN2288648 FACS IHC ELISA Rabbit IgG N-Term Log in to see Polyclonal
0.0011344266 ABIN1584598 IHC ELISA WB Rabbit Log in to see Polyclonal
0.0011344266 ABIN4324918 ELISA ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
0.0011344266 ABIN3048773 IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-IL21 Receptor antibody for Immunohistochemistry

Similar anti-IL21 Receptor Antibodies

Application / Reactivity Mouse (Murine)
Blocking Reagent (BR) 2 Antibodies
ELISA 16 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 15 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 12 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies
Western Blotting (WB) 21 Antibodies

General

Antigen Interleukin 21 Receptor (IL21R) Antibodies
Epitope N-Term, AA 35-65
(13), (13), (11), (8), (7), (4), (4), (2), (2), (1), (1), (1)
Reactivity Mouse (Murine)
(92), (50), (30), (2)
Host Rabbit
(71), (22), (15), (6)
Clonality
Polyclonal
Conjugate This IL21 Receptor antibody is un-conjugated
(8), (6), (6), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
(52), (38), (29), (21), (13), (11), (4), (4), (2), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Receptor Antibody

Target Details IL21 Receptor Application Details Handling Images
Specificity IL21 Receptor
Cross-Reactivity (Details) Expected to cross-react with Human,rat,(96% identity with immunogen) due to sequence homology. Not yet tested in other species.
Purification affinity purified
Immunogen Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.

Target Details IL21 Receptor

Product Details anti-IL21 Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 R (IL21R Antibody Abstract)
Background The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). Itbelongs to the type I cytokine receptors, and has been shown to form a heterodimericreceptor complex with the common gamma-chain, a receptor subunit also shared by thereceptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces thegrowth promoting signal of IL21, and is important for the proliferation and differentiationof T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leadsto the activation of multiple downstream signaling molecules, including JAK1, JAK3,STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for thisgene in regulating immunoglobulin production. Three alternatively spliced transcriptvariants encoding the same protein have been described. Alternate Names: anti-IL 21R antibody, anti-IL21 Receptor antibody, anti-IL21R antibody, anti-Interleukin21 receptor antibody, anti-MGC10967 antibody, anti-NILR antibody.
Gene Symbol: IL21R
Gene ID 50615
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Handling Images back to top
Application Notes Recommended dilutions: ELISA 1:100000, Immunohistochemistry 1:10-1:2000, Immunohistochemistry-Paraffin 1:10-1:2000
Restrictions For Research Use only

Handling

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Images back to top
Concentration 1.0 mg/mL
Buffer PBS [pH 7.2], Sodium Azide
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C
Storage Comment 4 °C short term. Aliquot and store at -20 °C long term.

Images

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 Receptor antibody (Interleukin 21 Receptor) (N-Term) (ABIN152158) Immunohistochemistry on mouse thymus with rabbit antibody to N-terminus of mouse IL-2...