You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 Receptor antibody for Immunohistochemistry

Recommended IL21 Receptor Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 Receptor (IL21R) Antibodies
  • IL21R
  • il-21ra.a
  • CD360
  • NILR
  • interleukin 21 receptor
  • IL21R
  • il21r
  • Il21r
Reactivity
Mouse (Murine)
99
53
31
2
Host
Rabbit
74
25
16
8
Clonality
Polyclonal
Conjugate
This IL21 Receptor antibody is un-conjugated
11
6
5
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
57
39
36
22
13
11
5
4
4
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN152158
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.500544 ABIN2421119 IHC ELISA Rabbit IgG Log in to see Polyclonal
8.500544 ABIN2427703 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1002623 IHC ELISA WB Rabbit IgG Extracellular Domain Log in to see Polyclonal 4
1 ABIN342780 FACS IHC ELISA Rabbit N-Term Log in to see Polyclonal
1 ABIN4324918 ELISA ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1905061 FACS IHC ELISA Rabbit N-Term Log in to see Polyclonal
1 ABIN2288648 FACS IHC ELISA Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2288646 IHC ELISA Rabbit IgG AA 35-46 Log in to see Polyclonal
1 ABIN1886904 IHC ELISA WB Rabbit AA 97-111 Log in to see Polyclonal
1 ABIN4904042 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1584598 IHC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN3048773 IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-IL21 Receptor antibody for Immunohistochemistry

Similar anti-IL21 Receptor Antibodies

Application / Reactivity Mouse (Murine)
Blocking Reagent (BR) 2 Antibodies
ELISA 16 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 17 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 13 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies
Western Blotting (WB) 23 Antibodies

General

Antigen Interleukin 21 Receptor (IL21R) Antibodies
Reactivity Mouse (Murine)
(99), (53), (31), (2)
Host Rabbit
(74), (25), (16), (8)
Clonality
Polyclonal
Conjugate This IL21 Receptor antibody is un-conjugated
(11), (6), (5), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
(57), (39), (36), (22), (13), (11), (5), (4), (4), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Receptor Antibody

Target Details IL21 Receptor Application Details Handling Images
Specificity IL21 Receptor
Cross-Reactivity (Details) Expected to cross-react with Human,rat,(96% identity with immunogen) due to sequence homology. Not yet tested in other species.
Purification Immunogen affinity purified
Immunogen Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.

Target Details IL21 Receptor

Product Details anti-IL21 Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 R (IL21R Antibody Abstract)
Background Gene Symbol: IL21R
Gene ID 50615
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Handling Images back to top
Application Notes ELISA 1:100000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer PBS ( pH 7.2)
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 Receptor antibody (Interleukin 21 Receptor) (ABIN152158) Immunohistochemistry on mouse thymus with rabbit antibody to N-terminus of mouse IL-2...