You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL3RA antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL3RA Antibody (supplied by: Log in to see )

Antigen
Interleukin 3 Receptor, alpha (Low Affinity) (IL3RA) Antibodies
  • Cyrl
  • CD123
  • IL3R
  • IL3RAY
  • IL3RX
  • IL3RY
  • hIL-3Ra
  • CDw123
  • SUT-1
  • interleukin 3 receptor, alpha
  • interleukin 3 receptor, alpha (low affinity)
  • interleukin 3 receptor, alpha chain
  • Il3ra
  • IL3RA
Reactivity
Human
248
56
4
Host
Rabbit
159
97
41
2
Clonality
Polyclonal
Conjugate
This IL3RA antibody is un-conjugated
25
22
20
11
11
8
7
5
5
5
5
5
5
4
4
4
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
182
148
61
46
30
27
25
24
13
13
9
8
8
6
5
3
3
2
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325126
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.701424 ABIN4325132 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
11.701424 ABIN747818 IF (p) IHC (p) WB Rabbit IgG AA 200-235 Log in to see Polyclonal
1 ABIN265478 EIA IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2855090 IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN476008 FACS IHC (fro) IHC (p) Mouse IgG1, kappa Log in to see 6H6
1 ABIN1905182 IHC (p) WB Rabbit AA 242-291 Log in to see Polyclonal
1 ABIN4325125 CyTOF ELISA FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 8E11C5
1 ABIN747827 IHC (p) WB HRP Rabbit IgG AA 200-235 Log in to see Polyclonal
1 ABIN1823498 ICC FACS IHC (p) ELISA WB Mouse IgG1 AA 200-305 Log in to see 8E11C5
1 ABIN747820 IHC (p) WB Biotin Rabbit IgG AA 200-235 Log in to see Polyclonal
1 ABIN1905181 ELISA FACS ICC IF IHC (p) WB Mouse IgG1 AA 200-305 Log in to see 10B8E7
1 ABIN2609928 IHC (fro) IHC (p) Mouse IgG1, kappa Log in to see CD123-D3
1 ABIN786708 IHC (fro) FACS IHC (p) IP Mouse IgG1 Log in to see 107D2-08 8

Top referenced anti-IL3RA antibody for Immunohistochemistry (Paraffin-embedded Sections)

  • Human Monoclonal IL3RA Primary Antibody for IHC (fro), FACS - ABIN786708 (8 Publications): Bachmann, Horn, Rudloff, Goren, Holdener, Christen, Darsow, Hunfeld, Koehl, Kind, Pfeilschifter, Kraiczy, Mühl: Early production of IL-22 but not IL-17 by peripheral blood mononuclear cells exposed to live Borrelia burgdorferi: the role of monocytes and interleukin-1. in PLoS pathogens 2010 (PubMed)

  • Human Polyclonal IL3RA Primary Antibody for IHC, IHC (p) - ABIN4325126 (1 Publications): Mansfield, Heikkila, von Smitten, Vakkila, Leidenius: Metastasis to sentinel lymph nodes in breast cancer is associated with maturation arrest of dendritic cells and poor co-localization of dendritic cells and CD8+ T cells. in Virchows Archiv : an international journal of pathology 2011 (PubMed)

Similar anti-IL3RA Antibodies

Application / Reactivity Human
Blocking Peptide (BP) 1 Antibodies
Blocking Reagent (BR) 3 Antibodies
Cell Culture (CC) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 1 Antibodies
Dot Blot (DB) 9 Antibodies
ELISA 53 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 143 Antibodies
Fluorescence Microscopy (FM) 1 Antibodies
Functional Studies (Func) 1 Antibodies
Immunochromatography (IC) 3 Antibodies
Immunocytochemistry (ICC) 13 Antibodies
Immunofluorescence (IF) 12 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 6 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 43 Antibodies

General

Antigen Interleukin 3 Receptor, alpha (Low Affinity) (IL3RA) Antibodies
Reactivity Human
(248), (56), (4)
Host Rabbit
(159), (97), (41), (2)
Clonality
Polyclonal
Conjugate This IL3RA antibody is un-conjugated
(25), (22), (20), (11), (11), (8), (7), (5), (5), (5), (5), (5), (5), (4), (4), (4), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(182), (148), (61), (46), (30), (27), (25), (24), (13), (13), (9), (8), (8), (6), (5), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-IL3RA Antibody

Target Details IL3RA Application Details Handling References for anti-IL3RA Antibody (ABIN4325126) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDIS
Isotype IgG

Target Details IL3RA

Product Details anti-IL3RA Antibody Application Details Handling References for anti-IL3RA Antibody (ABIN4325126) Images back to top
Antigen
Alternative Name IL-3 R alpha/cd123 (IL3RA Antibody Abstract)
Background Gene Symbol: IL3RA
Gene ID 3563
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL3RA Antibody Target Details IL3RA Handling References for anti-IL3RA Antibody (ABIN4325126) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL3RA Antibody Target Details IL3RA Application Details References for anti-IL3RA Antibody (ABIN4325126) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-IL3RA Antibody (ABIN4325126)

Product Details anti-IL3RA Antibody Target Details IL3RA Application Details Handling Images back to top
Product cited in:

Mansfield, Heikkila, von Smitten, Vakkila, Leidenius: "Metastasis to sentinel lymph nodes in breast cancer is associated with maturation arrest of dendritic cells and poor co-localization of dendritic cells and CD8+ T cells." in: Virchows Archiv : an international journal of pathology, Vol. 459, Issue 4, pp. 391-8, 2011

Images

Product Details anti-IL3RA Antibody Target Details IL3RA Application Details Handling References for anti-IL3RA Antibody (ABIN4325126) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IL3RA antibody (Interleukin 3 Receptor, alpha (Low Affinity)) (ABIN4325126) Immunohistochemistry-Paraffin: IL3RA Antibody [NBP1-86549] - Staining of human small ...
Western Blotting (WB) image for anti-IL3RA antibody (Interleukin 3 Receptor, alpha (Low Affinity)) (ABIN4325126) Western Blot: IL3RA Antibody [NBP1-86549] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...