anti-Human IL7 antibody for Immunohistochemistry

Recommended IL7 Antibody (supplied by: Log in to see )

Antigen
Interleukin 7 (IL7) Antibodies
  • IL7
  • IL-7
  • A630026I06Rik
  • Il-7
  • hlb368
  • interleukin 7
  • interleukin 7-like
  • IL7
  • Il7
  • LOC100345409
Reactivity
Human
187
80
43
2
1
1
1
1
1
1
Host
Rabbit
145
71
51
5
1
Clonality
Polyclonal
Conjugate
This IL7 antibody is un-conjugated
47
11
8
5
4
4
4
4
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
202
154
50
48
22
16
16
14
13
6
5
4
3
3
3
2
2
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325437
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.894592 ABIN2404464 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1102507 IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN964757 IHC Neut RIA ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1873218 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3022323 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1102508 IHC ELISA WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1078236 ICC IHC IP WB Rabbit IgG AA 26-177 Log in to see Polyclonal
1 ABIN1825565 IP IHC ELISA WB Mouse IgG1 Log in to see NYRhIL7
1 ABIN4226059 BP IHC IHC (p) Neut WB Mouse IgG1 Log in to see MM0410-12T6
1 ABIN1983297 Neut IHC WB Mouse IgG1 AA 26-177 Log in to see MM0410-12T6
1 ABIN2290379 IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2290382 IHC ELISA WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN2894439 IHC WB Rabbit Log in to see Polyclonal
1 ABIN218154 IP IHC ELISA WB Mouse IgG1 Log in to see
1 ABIN5598113 IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see MM0410-12T6
1 ABIN5598114 IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 Log in to see MM0410-12T6
1 ABIN5598115 IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 Log in to see MM0410-12T6
1 ABIN5598118 IHC IHC (p) WB DyLight 350 Mouse IgG1 Log in to see MM0410-12T6
1 ABIN5598120 IHC IHC (p) WB DyLight 488 Mouse IgG1 Log in to see MM0410-12T6
1 ABIN5598116 IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 Log in to see MM0410-12T6

General

Antigen Interleukin 7 (IL7) Antibodies
Reactivity Human
(187), (80), (43), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(145), (71), (51), (5), (1)
Clonality
Polyclonal
Conjugate This IL7 antibody is un-conjugated
(47), (11), (8), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(202), (154), (50), (48), (22), (16), (16), (14), (13), (6), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-IL7 Antibody

Target Details IL7 Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Isotype IgG

Target Details IL7

Product Details anti-IL7 Antibody Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Antigen
Alternative Name IL-7 (IL7 Antibody Abstract)
Background Gene Symbol: IL7
Gene ID 3574
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL7 Antibody Target Details IL7 Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL7 Antibody Target Details IL7 Application Details ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-IL7 antibody (ABIN4325437)

Product Details anti-IL7 Antibody Target Details IL7 Application Details Handling Images back to top
Product cited in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014

Images

Product Details anti-IL7 Antibody Target Details IL7 Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 7 (IL7) antibody (ABIN4325437) Immunohistochemistry: IL-7 Antibody [NBP1-83111] - Staining of human stomach, upper s...