anti-Human IL7 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL7 Antibody (supplied by: Log in to see )

Interleukin 7 (IL7) Antibodies
  • IL7
  • IL-7
  • A630026I06Rik
  • Il-7
  • hlb368
  • interleukin 7
  • interleukin 7-like
  • IL7
  • Il7
  • LOC100345409
This IL7 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325437
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4226059 BP IHC IHC (p) Neut WB Mouse IgG1 Log in to see MM0410-12T6

Top referenced anti-IL7 antibody for Immunohistochemistry (Paraffin-embedded Sections)

  • Human Polyclonal IL7 Primary Antibody for IHC, IHC (p) - ABIN4325437 (1 Publications): Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. in PLoS pathogens 2014 (PubMed)

Similar anti-IL7 Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 4 Antibodies
Blocking Peptide (BP) 2 Antibodies
Cell Culture (CC) 1 Antibodies
Dot Blot (DB) 2 Antibodies
ELISA 116 Antibodies
ELISA (Capture) 2 Antibodies
ELISA (Detection) 2 Antibodies
Enzyme Immunoassay (EIA) 8 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Functional Studies (Func) 9 Antibodies
Immunoassay (IA) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunohistochemistry (IHC) 29 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies
Immunoprecipitation (IP) 15 Antibodies
Intracellular Flow Cytometry (ICFC) 5 Antibodies


Antigen Interleukin 7 (IL7) Antibodies
Reactivity Human
(170), (66), (42), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(141), (57), (37), (5), (1)
Conjugate This IL7 antibody is un-conjugated
(43), (9), (7), (5), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(172), (152), (50), (34), (16), (16), (14), (13), (7), (6), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-IL7 Antibody

Target Details IL7 Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI
Isotype IgG

Target Details IL7

Product Details anti-IL7 Antibody Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Alternative Name IL-7 (IL7 Antibody Abstract)
Background Gene Symbol: IL7
Gene ID 3574
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL7 Antibody Target Details IL7 Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-IL7 Antibody Target Details IL7 Application Details ProductDetails: References for anti-IL7 antibody (ABIN4325437) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-IL7 antibody (ABIN4325437)

Product Details anti-IL7 Antibody Target Details IL7 Application Details Handling Images back to top
Product cited in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014


Product Details anti-IL7 Antibody Target Details IL7 Application Details Handling ProductDetails: References for anti-IL7 antibody (ABIN4325437) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL7 antibody (Interleukin 7) (ABIN4325437) Immunohistochemistry: IL-7 Antibody [NBP1-83111] - Staining of human stomach, upper s...