anti-Human Leptin antibody for Immunocytochemistry

Recommended Leptin Antibody (supplied by: Log in to see )

Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Human, Mouse (Murine), Rat (Rattus)
This Leptin antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4892220
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN152764 ICC IHC IHC (fro) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1859647 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 22-167 Log in to see
1 ABIN1078271 ICC IHC IP WB Rabbit IgG AA 22-167 Log in to see Polyclonal
1 ABIN1909642 ELISA FACS ICC IF IHC WB APC Rabbit IgG AA 8-37 Log in to see Polyclonal
1 ABIN1909645 ELISA FACS ICC IF IHC WB HRP Rabbit IgG AA 8-37 Log in to see Polyclonal
1 ABIN1909644 ELISA FACS ICC IF IHC WB PE Rabbit IgG AA 8-37 Log in to see Polyclonal
1 ABIN1909643 ELISA FACS ICC IF IHC WB FITC Rabbit IgG AA 8-37 Log in to see Polyclonal
1 ABIN2742565 ICC IF WB Rabbit IgG AA 91-106 Log in to see Polyclonal
1 ABIN2742564 ICC IHC (fro) WB Rabbit IgG AA 25-44 Log in to see Polyclonal
1 ABIN221407 ICC ELISA WB Rabbit IgG AA 1-24 Log in to see Polyclonal
1 ABIN5077811 ELISA FACS ICC IF WB Mouse IgG2b kappa AA 22-167 Log in to see 7E10
1 ABIN5077810 ELISA FACS ICC IF WB Mouse IgG2b kappa AA 22-167 Log in to see 7E10
1 ABIN5565621 FACS ICC IF IHC FITC Rabbit Log in to see Polyclonal
1 ABIN5565623 FACS ICC IF IHC PE Rabbit Log in to see Polyclonal
1 ABIN5565620 FACS ICC IF IHC APC Rabbit Log in to see Polyclonal

Similar anti-Leptin Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
Blocking Antibody (Inhibition) 1 Antibodies 1 Antibodies
ELISA 64 Antibodies 67 Antibodies
Enzyme Immunoassay (EIA) 6 Antibodies 10 Antibodies
Immunochromatography (IC) 1 Antibodies 1 Antibodies
Immunocytochemistry (ICC) 7 Antibodies 10 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 39 Antibodies
Immunohistochemistry (IHC) 23 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 14 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Radioimmunoassay (RIA) 3 Antibodies
Western Blotting (WB) 89 Antibodies


Antigen Leptin (LEP) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(416), (171), (150), (24), (8), (6), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(367), (207), (19), (8), (4), (1)
Conjugate This Leptin antibody is un-conjugated
(64), (26), (17), (14), (10), (7), (7), (7), (6), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(406), (400), (107), (56), (55), (39), (31), (31), (29), (26), (17), (10), (10), (6), (5), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected from the middle region of LEP (NP_000221). Peptide sequence LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM.

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Alternative Name Leptin/OB (LEP Antibody Abstract)
Background Gene Symbol: LEP
Molecular Weight Theoretical MW: 16 kDa
Gene ID 3952
UniProt P41159
Pathways JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 4-8 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mL, ImmunocytochemistryThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Simple Western (SimWes) image for anti-Leptin antibody (LEP) (ABIN4892220) Simple Western: Leptin/OB Antibody [NBP1-59324] - Simple Western analysis of Leptin. ...
Immunocytochemistry (ICC) image for anti-Leptin antibody (LEP) (ABIN4892220) Immunocytochemistry: Leptin/OB Antibody [NBP1-59324] - Rat and mouse brain, 10 ug/ml....
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leptin antibody (LEP) (ABIN4892220) Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324] - Human pancreas tissu...
Western Blotting (WB) image for anti-Leptin antibody (LEP) (ABIN4892220) Western Blot: Leptin/OB Antibody [NBP1-59324] - Titration: 0.2-1 ug/ml, Positive Cont...