You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Leptin antibody for Immunohistochemistry

Recommended Leptin Antibody (supplied by: Log in to see )

Antigen
Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Epitope
N-Term
24
22
21
13
13
11
10
8
6
6
6
6
6
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
414
153
132
18
3
2
2
1
Host
Rabbit
354
212
20
8
4
Clonality
Polyclonal
Conjugate
This Leptin antibody is un-conjugated
65
23
17
11
7
7
7
5
5
4
4
4
4
4
4
4
4
4
4
4
4
3
3
3
3
3
3
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
413
386
86
60
40
33
26
25
19
17
16
14
10
7
5
3
3
3
2
2
1
1
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2776943
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.514159 ABIN2776944 IHC WB Rabbit Middle Region Log in to see Polyclonal
8.514159 ABIN152764 ICC IHC IHC (fro) WB Rabbit IgG Log in to see Polyclonal
8.514159 ABIN2469665 IHC ELISA WB Rabbit Log in to see Polyclonal
8.514159 ABIN3031600 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 8-37 Log in to see Polyclonal
8.514159 ABIN2489204 FACS IF IHC WB Rabbit Ig Fraction AA 7-37, N-Term Log in to see Polyclonal
8.514159 ABIN4904218 IHC WB Rabbit IgG Log in to see Polyclonal
8.514159 ABIN2421035 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1585862 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN108520 IP IHC ELISA WB Rabbit Log in to see Polyclonal 5
1 ABIN1909643 ICC FACS IHC ELISA WB FITC Rabbit IgG N-Term, AA 7-37 Log in to see Polyclonal
1 ABIN1909642 ICC FACS IHC ELISA WB APC Rabbit IgG N-Term, AA 7-37 Log in to see Polyclonal
1 ABIN1909644 ICC FACS IHC ELISA WB PE Rabbit IgG N-Term, AA 7-37 Log in to see Polyclonal
1 ABIN1876874 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1583099 IHC ELISA Mouse IgG1 kappa Log in to see
1 ABIN1909645 ICC FACS IHC ELISA WB HRP Rabbit IgG N-Term, AA 7-37 Log in to see Polyclonal
1 ABIN2892881 IHC Rabbit Lys36 Log in to see Polyclonal
1 ABIN3021884 FACS IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4330701 ELISA IHC IHC (p) Mouse IgG1 kappa Log in to see 3
1 ABIN1822625 IF IHC Rabbit IgG AA 22-56 Log in to see Polyclonal
1 ABIN1822626 IF IHC Rabbit IgG AA 116-167 Log in to see Polyclonal

Top referenced anti-Leptin antibody for Immunohistochemistry

Similar anti-Leptin Antibodies

Application / Reactivity Mouse (Murine) Human
Blocking Antibody (Inhibition) 1 Antibodies 3 Antibodies
ELISA 67 Antibodies
Enzyme Immunoassay (EIA) 10 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 33 Antibodies
Immunohistochemistry (IHC) 24 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 20 Antibodies
Immunohistochemistry (Paraformaldehyde) (IHC (pfa)) 1 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Neutralization (Neut) 1 Antibodies
Radioimmunoassay (RIA) 2 Antibodies
Western Blotting (WB) 95 Antibodies
Blocking Peptide (BP) 1 Antibodies
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 1 Antibodies

General

Antigen Leptin (LEP) Antibodies
Epitope N-Term
(24), (22), (21), (13), (13), (11), (10), (8), (6), (6), (6), (6), (6), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine)
(414), (153), (132), (18), (3), (2), (2), (1)
Host Rabbit
(354), (212), (20), (8), (4)
Clonality
Polyclonal
Conjugate This Leptin antibody is un-conjugated
(65), (23), (17), (11), (7), (7), (7), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(413), (386), (86), (60), (40), (33), (26), (25), (19), (17), (16), (14), (10), (7), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Blocking Peptide Blocking peptide for this product available: ABIN979272
Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVT RINDISHTQS
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 90 %, Goat : 90 %, Sheep : 90 %, Bovine : 80 %, Dog : 80 %, Horse : 70 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against LEP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LEP

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Antigen
Alternative Name LEP (LEP Antibody Abstract)
Background LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regula
Molecular Weight 19 kDa
Gene ID 3952
NCBI Accession NM_000230, NP_000221
UniProt P41159
Pathways JAK-STAT Signaling, AMPK Signaling

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 167 AA

Restrictions For Research Use only

Handling

Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Liquid
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Images

Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Leptin antibody (LEP) (N-Term) (ABIN2776943) anti-Leptin (LEP) (N-Term) antibody