You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) Leptin antibody for ELISA

Recommended Leptin Antibody (supplied by: Log in to see )

Leptin (LEP) Antibodies
  • LEPD
  • OB
  • ob
  • obese
  • OBS
AA 74-109, Middle Region
Mouse (Murine)
This Leptin antibody is un-conjugated
ELISA, Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043294
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0012487897 ABIN214037 IHC (p) ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN1585862 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0012487897 ABIN103522 ELISA WB Rabbit IgG Log in to see Polyclonal
0.0012487897 ABIN108521 ELISA WB Rabbit Log in to see Polyclonal 4
0.0012487897 ABIN108522 ELISA WB Rabbit Log in to see Polyclonal 6
0.0012487897 ABIN2469665 IHC ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN465756 ELISA WB Biotin Rabbit Log in to see Polyclonal
0.0012487897 ABIN1169154 IP ELISA WB Biotin Rabbit Log in to see Polyclonal
0.0012487897 ABIN1078272 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 22-167 Log in to see Polyclonal
0.0012487897 ABIN3201294 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 22-167 Log in to see
0.0012487897 ABIN205695 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
0.0012487897 ABIN465757 IHC (pfa) ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN1169151 IP ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN103521 ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN799626 ELISA WB Rabbit Log in to see Polyclonal
0.0012487897 ABIN1584698 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0012487897 ABIN2612674 ELISA Biotin Rabbit IgG AA 22-167 Log in to see Polyclonal
0.0012487897 ABIN2612677 ELISA FITC Rabbit IgG AA 22-167 Log in to see Polyclonal
0.0012487897 ABIN2475320 ELISA Sheep IgG AA 57-70 Log in to see Polyclonal 2
0.0012487897 ABIN576771 ELISA Sheep AA 57-70 Log in to see Polyclonal

Top referenced anti-Leptin antibody for ELISA

Similar anti-Leptin Antibodies

Application / Reactivity Mouse (Murine)
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 67 Antibodies
Enzyme Immunoassay (EIA) 10 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 33 Antibodies
Immunohistochemistry (IHC) 23 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 20 Antibodies
Immunohistochemistry (Paraformaldehyde) (IHC (pfa)) 1 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Neutralization (Neut) 1 Antibodies
Radioimmunoassay (RIA) 2 Antibodies
Western Blotting (WB) 93 Antibodies


Antigen Leptin (LEP) Antibodies
Epitope AA 74-109, Middle Region
(24), (22), (21), (13), (13), (11), (9), (8), (6), (6), (6), (6), (6), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(412), (151), (132), (18), (3), (2), (2), (1)
Host Rabbit
(349), (213), (20), (8), (4)
Conjugate This Leptin antibody is un-conjugated
(65), (23), (17), (11), (7), (7), (7), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2)
Application ELISA, Western Blotting (WB)
(413), (381), (71), (59), (41), (33), (26), (25), (19), (17), (16), (14), (10), (7), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
Gene Name: leptin
Protein Name: Leptin
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
Isotype IgG

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Alternative Name LEP (LEP Antibody Abstract)
Background Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.
Gene ID 16846
UniProt P41160
Pathways JAK-STAT Signaling, AMPK Signaling

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only


Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C,4 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Leptin antibody (LEP) (AA 74-109) (ABIN3043294) Observed bind size: 16KD