You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) Leptin antibody for Immunohistochemistry

Recommended Leptin Antibody (supplied by: Log in to see )

Antigen
Leptin (LEP) Antibodies
  • LEPD
  • OB
  • ob
  • obese
  • OBS
Epitope
N-Term
24
21
21
13
13
11
9
8
6
6
6
6
6
3
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
440
150
131
18
3
1
1
Host
Rabbit
348
243
20
8
4
Clonality
Polyclonal
Conjugate
This Leptin antibody is un-conjugated
66
25
19
13
9
9
7
6
6
6
6
6
6
6
6
6
6
6
6
5
5
3
3
3
3
3
3
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
445
410
68
57
39
33
26
25
17
17
16
13
10
7
5
3
3
3
3
2
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2776943
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.22487204 ABIN2776944 IHC WB Rabbit Middle Region Log in to see Polyclonal
0.22487204 ABIN2469665 IHC ELISA WB Rabbit Log in to see Polyclonal
0.22487204 ABIN2427621 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.22487204 ABIN2421035 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1585862 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0011312889 ABIN1876874 IHC WB Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1584698 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0011312889 ABIN2299730 IC IHC WB Rabbit IgG AA 25-44 Log in to see Polyclonal
0.0011312889 ABIN2406454 IHC WB Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1172249 IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1088067 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1088068 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN1862846 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN2299605 IHC ELISA Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN2299641 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN2299510 IHC ELISA WB Rabbit Log in to see Polyclonal
0.0011312889 ABIN2976167 IHC WB Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN308671 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011312889 ABIN2490147 IHC ELISA WB Rabbit Log in to see Polyclonal
0.0011312889 ABIN2793938 IHC (p) IHC ELISA WB Rabbit Log in to see Polyclonal

Similar anti-Leptin Antibodies

Application / Reactivity Mouse (Murine) Human
Blocking Antibody (Inhibition) 1 Antibodies 3 Antibodies
ELISA 68 Antibodies 337 Antibodies
Enzyme Immunoassay (EIA) 10 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 33 Antibodies
Immunohistochemistry (IHC) 22 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 19 Antibodies
Immunohistochemistry (Paraformaldehyde) (IHC (pfa)) 1 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Neutralization (Neut) 1 Antibodies
Radioimmunoassay (RIA) 2 Antibodies
Western Blotting (WB) 91 Antibodies
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 1 Antibodies

General

Antigen Leptin (LEP) Antibodies
Epitope N-Term
(24), (21), (21), (13), (13), (11), (9), (8), (6), (6), (6), (6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine)
(440), (150), (131), (18), (3), (1), (1)
Host Rabbit
(348), (243), (20), (8), (4)
Clonality
Polyclonal
Conjugate This Leptin antibody is un-conjugated
(66), (25), (19), (13), (9), (9), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (5), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(445), (410), (68), (57), (39), (33), (26), (25), (17), (17), (16), (13), (10), (7), (5), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Blocking Peptide Blocking peptide for this product available: ABIN979272
Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVT RINDISHTQS
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 90 %, Goat : 90 %, Sheep : 90 %, Bovine : 80 %, Dog : 80 %, Horse : 70 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against LEP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LEP

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Antigen
Alternative Name LEP (LEP Antibody Abstract)
Background LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regula
Molecular Weight 19 kDa
Gene ID 3952
NCBI Accession NM_000230, NP_000221
UniProt P41159
Pathways JAK-STAT Signaling, AMPK Signaling

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 167 AA

Restrictions For Research Use only

Handling

Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Liquid
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Images

Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Leptin antibody (LEP) (N-Term) (ABIN2776943) anti-Leptin (LEP) (N-Term) antibody