You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Oncostatin M antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Oncostatin M Antibody (supplied by: Log in to see )

Antigen
Oncostatin M (OSM) Antibodies
  • OSM
  • OncoM
  • oncostatin M
  • oncostatin M-like
  • oncostatin-M-like
  • OSM
  • Osm
  • LOC100342491
  • LOC100152038
Reactivity
Human
157
30
15
1
Host
Rabbit
126
42
2
2
1
Clonality
Polyclonal
Conjugate
This Oncostatin M antibody is un-conjugated
21
11
9
4
4
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
118
85
41
33
22
15
12
6
4
4
4
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4341425
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.398621 ABIN4341424 IHC IHC (p) WB Mouse IgG1 Log in to see 2B6 1
1 ABIN3043458 IHC (p) ELISA WB Rabbit IgG AA 26-220 Log in to see Polyclonal
1 ABIN3043117 IHC (p) WB Rabbit IgG AA 181-198, Middle Region Log in to see Polyclonal
1 ABIN116203 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1491278 IHC (p) WB Mouse IgG1 AA 25-252 Log in to see 2B6
1 ABIN116204 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1869634 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 26-220 Log in to see Polyclonal
1 ABIN2626460 IHC (p) WB Rabbit IgG AA 181-198 Log in to see Polyclonal
1 ABIN4962788 ELISA IHC IHC (p) WB Alexa Fluor 647 Mouse IgG2a Log in to see 17001-31
1 ABIN709610 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN717035 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN265813 BP ELISA IHC IHC (p) Neut WB Mouse IgG2a Log in to see 17001-31
1 ABIN4341433 ELISA IHC IHC (p) WB Alexa Fluor 405 Mouse IgG2a Log in to see 17001-31
1 ABIN4341434 ELISA IHC IHC (p) WB Alexa Fluor 700 Mouse IgG2a Log in to see 17001-31
1 ABIN4341436 ELISA IHC IHC (p) WB Biotin Mouse IgG2a Log in to see 17001-31
1 ABIN4341437 ELISA IHC IHC (p) WB DyLight 650 Mouse IgG2a Log in to see 17001-31
1 ABIN4341438 ELISA IHC IHC (p) FITC Mouse IgG2a Log in to see 17001-31
1 ABIN4341439 ELISA IHC IHC (p) WB DyLight 680 Mouse IgG2a Log in to see 17001-31
1 ABIN4341440 ELISA IHC IHC (p) WB DyLight 488 Mouse IgG2a Log in to see 17001-31
1 ABIN4341441 ELISA IHC IHC (p) WB DyLight 755 Mouse IgG2a Log in to see 17001-31

Top referenced anti-Oncostatin M antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Oncostatin M Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 3 Antibodies
Blocking Peptide (BP) 2 Antibodies
ELISA 76 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 4 Antibodies
Flow Cytometry (FACS) 15 Antibodies
Functional Studies (Func) 6 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 22 Antibodies
Immunohistochemistry (IHC) 34 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 39 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Neutralization (Neut) 12 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 110 Antibodies

General

Antigen Oncostatin M (OSM) Antibodies
Reactivity Human
(157), (30), (15), (1)
Host Rabbit
(126), (42), (2), (2), (1)
Clonality
Polyclonal
Conjugate This Oncostatin M antibody is un-conjugated
(21), (11), (9), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(118), (85), (41), (33), (22), (15), (12), (6), (4), (4), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Oncostatin M Antibody

Target Details Oncostatin M Application Details Handling References for anti-Oncostatin M Antibody (ABIN4341425) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMA
Isotype IgG

Target Details Oncostatin M

Product Details anti-Oncostatin M Antibody Application Details Handling References for anti-Oncostatin M Antibody (ABIN4341425) Images back to top
Antigen
Alternative Name Oncostatin M/OSM (OSM Antibody Abstract)
Background Gene Symbol: OSM
Molecular Weight Theoretical MW: 28 kDa
Gene ID 5008
UniProt P13725
Pathways JAK-STAT Signaling

Application Details

Product Details anti-Oncostatin M Antibody Target Details Oncostatin M Handling References for anti-Oncostatin M Antibody (ABIN4341425) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Oncostatin M Antibody Target Details Oncostatin M Application Details References for anti-Oncostatin M Antibody (ABIN4341425) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Oncostatin M Antibody (ABIN4341425)

Product Details anti-Oncostatin M Antibody Target Details Oncostatin M Application Details Handling Images back to top
Product cited in:

Guo, Chen, Shi, Wang, Chen, Diao, Hu, Yu, Qian, Guo: "Stat3-coordinated Lin-28-let-7-HMGA2 and miR-200-ZEB1 circuits initiate and maintain oncostatin M-driven epithelial-mesenchymal transition." in: Oncogene, Vol. 32, Issue 45, pp. 5272-82, 2013

Images

Product Details anti-Oncostatin M Antibody Target Details Oncostatin M Application Details Handling References for anti-Oncostatin M Antibody (ABIN4341425) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Oncostatin M antibody (OSM) (ABIN4341425) Immunohistochemistry-Paraffin: Oncostatin M Antibody [NBP1-87768] - Staining of human...
Western Blotting (WB) image for anti-Oncostatin M antibody (OSM) (ABIN4341425) Western Blot: Oncostatin M Antibody [NBP1-87768] - Lane 1: Marker [kDa] 250, 130, 95,...