anti-Human PIAS3 antibody for Immunocytochemistry

Recommended PIAS3 Antibody (supplied by: Log in to see )

Protein Inhibitor of Activated STAT, 3 (PIAS3) Antibodies
  • PIAS3
  • Pias3l
  • ZMIZ5
  • protein inhibitor of activated STAT 3
  • protein inhibitor of activated STAT, 3
  • protein inhibitor of activated STAT 3 L homeolog
  • PIAS3
  • pias3
  • Pias3
  • pias3.L
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078818
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1869799 ICC IHC IP WB Rabbit IgG AA 11-280 Log in to see Polyclonal


Antigen Protein Inhibitor of Activated STAT, 3 (PIAS3) Antibodies
Reactivity Human
(66), (31), (28), (8), (7), (5), (4), (3), (2), (1)
Host Rabbit
(62), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(60), (35), (32), (15), (5), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-PIAS3 Antibody

Target Details PIAS3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD
Isotype IgG

Target Details PIAS3

Product Details anti-PIAS3 Antibody Application Details Handling Images back to top
Alternative Name PIAS3 (PIAS3 Antibody Abstract)
Background Gene Symbol: PIAS3
Gene ID 10401
Research Area Transcription Factors, Chromatin and Nuclear Signaling
Pathways JAK-STAT Signaling

Application Details

Product Details anti-PIAS3 Antibody Target Details PIAS3 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PIAS3 Antibody Target Details PIAS3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-PIAS3 Antibody Target Details PIAS3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Protein Inhibitor of Activated STAT, 3 (PIAS3) antibody (ABIN5078818) Immunocytochemistry/Immunofluorescence: PIAS3 Antibody - Staining of human cell line...