anti-Human Prolactin Receptor antibody for Western Blotting

Recommended Prolactin Receptor Antibody (supplied by: Log in to see )

Antigen
Prolactin Receptor (PRLR) Antibodies
  • hPRLrI
  • PRL-R
  • prlr
  • PRLRb
  • PRLR
  • tprlr
  • DKFZp469D061
  • RATPRLR
  • AI987712
  • Pr-1
  • Pr-3
  • Prlr-rs1
  • wu:fj65c07
  • prolactin receptor
  • prolactin receptor L homeolog
  • prolactin receptor S homeolog
  • prolactin receptor a
  • PRLR
  • prlr.L
  • prlr.S
  • PR
  • prlr
  • Prlr
  • prlra
Epitope
AA 565-605, C-Term
15
7
6
6
6
5
5
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Reactivity
Human
206
67
36
17
17
16
15
15
13
2
2
2
2
1
Host
Rabbit
161
67
6
4
Clonality
Polyclonal
Conjugate
This Prolactin Receptor antibody is un-conjugated
7
7
7
7
6
6
6
6
6
6
6
6
6
5
4
4
2
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
175
131
109
107
92
88
80
80
51
13
4
2
2
2
2
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043553
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.210425 ABIN783326 WB Rabbit AA 25-29 Log in to see Polyclonal 3
3.210425 ABIN3043973 IHC (p) WB Rabbit IgG AA 591-605, C-Term Log in to see Polyclonal
3.210425 ABIN1881684 WB Rabbit AA 147-179, Center Log in to see Polyclonal 5
3.210425 ABIN1387937 IF (p) IHC (p) WB Rabbit IgG AA 270-305 Log in to see Polyclonal
3.210425 ABIN519288 WB Rabbit AA 1-622, full length Log in to see Polyclonal 1
3.210425 ABIN4347641 EM ICC IF WB Rabbit Log in to see Polyclonal
3.210425 ABIN4904864 WB Rabbit IgG Log in to see Polyclonal
3.210425 ABIN519287 WB Mouse AA 1-622, full length Log in to see Polyclonal
3.210425 ABIN519289 ELISA WB Mouse IgG2b kappa AA 371-479, partial Log in to see 1E4
3.210425 ABIN3032320 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
3.210425 ABIN5014158 ICC IHC IP WB Rabbit IgG AA 25-234 Log in to see Polyclonal
1 ABIN152720 ICC FACS IHC (fro) IF IHC (p) IP IHC WB Mouse IgG1 Log in to see U5 10
1 ABIN113941 EIA WB Sheep AA 1-14, N-Term Log in to see Polyclonal 2
1 ABIN871667 WB Rabbit AA 25-29 Log in to see Polyclonal 3
1 ABIN5515079 WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN209188 ICC FACS IHC (fro) IHC (p) IP WB Mouse IgG1 Extracellular Domain Log in to see U5
1 ABIN1415217 IHC (p) WB HRP Rabbit IgG AA 270-305 Log in to see Polyclonal
1 ABIN351557 IHC (p) IP WB Rabbit Log in to see Polyclonal
1 ABIN2476231 ELISA WB Sheep IgG AA 1-14 Log in to see Polyclonal 2
1 ABIN1397343 IHC (p) WB Biotin Rabbit IgG AA 270-305 Log in to see Polyclonal

General

Antigen Prolactin Receptor (PRLR) Antibodies
Epitope AA 565-605, C-Term
(15), (7), (6), (6), (6), (5), (5), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(206), (67), (36), (17), (17), (16), (15), (15), (13), (2), (2), (2), (2), (1)
Host Rabbit
(161), (67), (6), (4)
Clonality
Polyclonal
Conjugate This Prolactin Receptor antibody is un-conjugated
(7), (7), (7), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(175), (131), (109), (107), (92), (88), (80), (80), (51), (13), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Prolactin Receptor Antibody

Target Details Prolactin Receptor Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.
Sequence HAKNVACFEE SAKEAPPSLE QNQAEKALAN FTATSSKCRL Q
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.
Gene Name: prolactin receptor
Protein Name: Prolactin receptor
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino acids.
Isotype IgG

Target Details Prolactin Receptor

Product Details anti-Prolactin Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name PRLR (PRLR Antibody Abstract)
Background PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.

Synonyms: AI987712 antibody|CLONE SPM213 antibody|CPRLP antibody|Delta 4-delta 7/11 truncated prolactin receptor antibody|Delta 4-SF1b truncated prolactin receptor antibody|hPRL receptor antibody|hPRLrI antibody|Lactogen receptor antibody|MGC105486 antibody|OPR antibody| OTTHUMP00000115998 antibody|Pr-1 antibody|Pr-3 antibody|PRL R antibody|PRL-R antibody|PRLR antibody|Prlr-rs1 antibody|PRLR_HUMAN antibody|Prolactin receptor a antibody| Prolactin receptor antibody|Prolactin receptor delta 7/11 antibody|RATPRLR antibody| Secreted prolactin binding protein antibody|Truncated testis-specific box 1-C prolactin receptor antibody|wu:fj65c07 antibody
Gene ID 5618
UniProt P16471
Pathways JAK-STAT Signaling, Response to Growth Hormone Stimulus

Application Details

Product Details anti-Prolactin Receptor Antibody Target Details Prolactin Receptor Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only

Handling

Product Details anti-Prolactin Receptor Antibody Target Details Prolactin Receptor Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-Prolactin Receptor Antibody Target Details Prolactin Receptor Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Prolactin Receptor (PRLR) (AA 565-605), (C-Term) antibody (ABIN3043553) anti-Prolactin Receptor (PRLR) (AA 565-605), (C-Term) antibody