You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Cow (Bovine) SRC antibody for Western Blotting

Recommended SRC Antibody (supplied by: Log in to see )

Antigen
V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian) (SRC) Antibodies
  • AW259666
  • pp60c-src
  • C-src1
  • CG7524
  • D-Src64B
  • D-src
  • DSRC64
  • DSrc
  • DSrc64
  • DSrc64B
  • Dm SRC1
  • DmHD-358
  • Dmel\CG7524
  • Dsrc
  • Dsrc64
  • Dsrc64B
  • HD-358
  • MRE5
  • SRC 64B
  • Src
  • Src1
  • Src64
  • c-src
  • dSrc
  • dsrc
  • src
  • src1
  • src64
  • src64B
  • src64b
  • ASV
  • SRC1
  • c-SRC
  • p60-Src
  • c-Src
  • PP60C-SCR
  • SDR
  • v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
  • proto-oncogene tyrosine-protein kinase src
  • Rous sarcoma oncogene
  • Src oncogene at 64B
  • v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
  • v-src sarcoma viral oncogene
  • SRC
  • AaeL_AAEL002471
  • CpipJ_CPIJ010659
  • Src
  • Src64B
Epitope
N-Term
58
32
31
27
25
24
18
15
15
11
11
8
8
6
5
5
5
4
4
4
4
3
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
408
238
193
31
16
16
12
11
9
6
5
5
5
4
4
2
2
1
1
1
1
1
1
Host
Rabbit
359
71
1
Clonality
Polyclonal
Conjugate
This SRC antibody is un-conjugated
19
15
15
14
13
13
3
3
2
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
358
199
143
49
37
27
24
20
12
9
5
5
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2779668
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0726016 ABIN2779669 WB Rabbit N-Term Log in to see Polyclonal
3.0726016 ABIN2704554 WB Rabbit C-Term, pTyr419 Log in to see Polyclonal
3.0726016 ABIN2704556 IC IF IHC WB Rabbit C-Term Log in to see Polyclonal
1 ABIN467755 WB Rabbit N-Term Log in to see Polyclonal
1 ABIN467756 WB Rabbit AA 36-85 Log in to see Polyclonal
1 ABIN461967 IHC (p) WB Rabbit AA 92-109 Log in to see Polyclonal
1 ABIN602330 IHC WB Rabbit IgG pTyr529 Log in to see Polyclonal
1 ABIN2628722 WB Rabbit IgG AA 514-536 Log in to see Polyclonal
1 ABIN602331 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN597793 WB Rabbit IgG Log in to see Polyclonal
1 ABIN1585687 IP IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2628731 ICC IF IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2628733 WB Rabbit pTyr419 Log in to see Polyclonal
1 ABIN2467430 IHC WB Rabbit AA 92-109 Log in to see Polyclonal
1 ABIN2992701 IF/ICC IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-SRC antibody for Western Blotting

  • Cow (Bovine) Polyclonal SRC Primary Antibody for WB - ABIN2779668 (1 Publications): Pechkovsky, Scaffidi, Hackett, Ballard, Shaheen, Thompson, Thannickal, Knight: Transforming growth factor beta1 induces alphavbeta3 integrin expression in human lung fibroblasts via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway. in The Journal of biological chemistry 2008 (PubMed)

Similar anti-SRC Antibodies

Application / Reactivity Human Mouse (Murine) Rat (Rattus) Cow (Bovine) Dog (Canine)
Immunofluorescence (fixed cells) (IF/ICC) 9 Antibodies 6 Antibodies 4 Antibodies 1 Antibodies
Western Blotting (WB) 338 Antibodies 197 Antibodies 158 Antibodies 16 Antibodies 12 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Intracellular Staining (ICS) 3 Antibodies 3 Antibodies 3 Antibodies
Immunoprecipitation (IP) 21 Antibodies 10 Antibodies 9 Antibodies 1 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 50 Antibodies 36 Antibodies

General

Antigen V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian) (SRC) Antibodies
Epitope N-Term
(58), (32), (31), (27), (25), (24), (18), (15), (15), (11), (11), (8), (8), (6), (5), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
(408), (238), (193), (31), (16), (16), (12), (11), (9), (6), (5), (5), (5), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(359), (71), (1)
Clonality
Polyclonal
Conjugate This SRC antibody is un-conjugated
(19), (15), (15), (14), (13), (13), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(358), (199), (143), (49), (37), (27), (24), (20), (12), (9), (5), (5), (3), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-SRC Antibody

Target Details SRC Application Details Handling References for anti-SRC Antibody (ABIN2779668) Images
Blocking Peptide Blocking peptide for this product available: ABIN984404
Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSK PASADGHRGP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %, Pig : 90 %, Bovine : 80 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SRC

Target Details SRC

Product Details anti-SRC Antibody Application Details Handling References for anti-SRC Antibody (ABIN2779668) Images back to top
Antigen
Alternative Name SRC (SRC Antibody Abstract)
Background This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 60 kDa
Gene ID 6714
NCBI Accession NM_198291, NP_938033
UniProt P12931
Research Area Signaling
Pathways JAK-STAT Signaling, Neurotrophin Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Cellular Response to Molecule of Bacterial Origin, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-SRC Antibody Target Details SRC Handling References for anti-SRC Antibody (ABIN2779668) Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 536 AA

Restrictions For Research Use only

Handling

Product Details anti-SRC Antibody Target Details SRC Application Details References for anti-SRC Antibody (ABIN2779668) Images back to top
Format Liquid
Concentration 1 mg/mL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

References for anti-SRC Antibody (ABIN2779668)

Product Details anti-SRC Antibody Target Details SRC Application Details Handling Images back to top
Background publications

Pechkovsky, Scaffidi, Hackett, Ballard, Shaheen, Thompson, Thannickal, Knight: "Transforming growth factor beta1 induces alphavbeta3 integrin expression in human lung fibroblasts via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway." in: The Journal of biological chemistry, Vol. 283, Issue 19, pp. 12898-908, 2008

Images

Product Details anti-SRC Antibody Target Details SRC Application Details Handling References for anti-SRC Antibody (ABIN2779668) back to top
Supplier Images
Western Blotting (WB) image for anti-SRC antibody (V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian)) (N-Term) (ABIN2779668) WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1...