You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) SRC antibody for Western Blotting

Recommended SRC Antibody (supplied by: Log in to see )

Antigen
V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian) (SRC) Antibodies
  • AW259666
  • pp60c-src
  • C-src1
  • CG7524
  • D-Src64B
  • D-src
  • DSRC64
  • DSrc
  • DSrc64
  • DSrc64B
  • Dm SRC1
  • DmHD-358
  • Dmel\CG7524
  • Dsrc
  • Dsrc64
  • Dsrc64B
  • HD-358
  • MRE5
  • SRC 64B
  • Src
  • Src1
  • Src64
  • c-src
  • dSrc
  • dsrc
  • src
  • src1
  • src64
  • src64B
  • src64b
  • ASV
  • SRC1
  • c-SRC
  • p60-Src
  • c-Src
  • PP60C-SCR
  • SDR
  • v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
  • proto-oncogene tyrosine-protein kinase src
  • Rous sarcoma oncogene
  • Src oncogene at 64B
  • v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
  • v-src sarcoma viral oncogene
  • SRC
  • AaeL_AAEL002471
  • CpipJ_CPIJ010659
  • Src
  • Src64B
Epitope
N-Term
75
34
30
26
26
24
19
15
14
13
11
8
6
6
5
5
4
4
4
4
4
4
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
420
192
154
21
8
7
6
4
4
2
2
2
2
1
1
1
1
1
1
1
1
Host
Rabbit
371
73
1
Clonality
Polyclonal
Conjugate
This SRC antibody is un-conjugated
19
15
15
14
13
13
3
3
2
2
2
2
2
2
2
1
Application
Western Blotting (WB)
361
205
161
39
34
25
23
21
12
7
5
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2779668
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
2.9499688 ABIN1531972 IHC ELISA WB Rabbit IgG pTyr529 Log in to see Polyclonal 2
2.9499688 ABIN1532080 IHC ELISA WB Rabbit IgG pSer75 Log in to see Polyclonal 1
2.9499688 ABIN1532102 ELISA WB Rabbit IgG pTyr216 Log in to see Polyclonal 1
2.9499688 ABIN1533137 ELISA WB Rabbit IgG Log in to see Polyclonal 1
2.9499688 ABIN1533006 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 2
2.9499688 ABIN387822 IF WB Mouse IgG1 Log in to see 17AT28 2
2.9499688 ABIN408484 ICC IF IHC (p) IHC WB Rabbit IgG pTyr418 Log in to see Polyclonal 4
2.9499688 ABIN2779669 WB Rabbit N-Term Log in to see Polyclonal
2.9499688 ABIN1531971 IHC ELISA WB Rabbit IgG pTyr418 Log in to see Polyclonal
2.9499688 ABIN1533114 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
2.9499688 ABIN1533005 ELISA WB Rabbit IgG Log in to see Polyclonal
2.9499688 ABIN392107 IF IHC (p) WB Rabbit Ig AA 1-30, N-Term Log in to see Polyclonal
2.9499688 ABIN1870630 IF IHC WB Rabbit IgG pTyr529 Log in to see Polyclonal
2.9499688 ABIN1870631 IHC WB Rabbit IgG pTyr418 Log in to see Polyclonal
2.9499688 ABIN3184111 ELISA WB Rabbit IgG Tyr1161 Log in to see Polyclonal
2.9499688 ABIN3184112 ELISA WB Rabbit IgG Tyr1161 Log in to see Polyclonal
2.9499688 ABIN3184113 ELISA IHC WB Rabbit IgG Tyr1165, Tyr1166 Log in to see Polyclonal
2.9499688 ABIN3182185 ELISA IHC WB Rabbit IgG pTyr419 Log in to see Polyclonal
2.9499688 ABIN3182677 ELISA IHC WB Rabbit IgG pSer75 Log in to see Polyclonal
2.9499688 ABIN3181976 ELISA IHC WB Rabbit IgG pTyr419 Log in to see Polyclonal

Top referenced anti-SRC antibody for Western Blotting

Similar anti-SRC Antibodies

Application / Reactivity Human Mouse (Murine) Rat (Rattus) Cow (Bovine) Dog (Canine)
Western Blotting (WB) 340 Antibodies 153 Antibodies 121 Antibodies 7 Antibodies 6 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Intracellular Staining (ICS) 3 Antibodies 3 Antibodies 3 Antibodies
Immunoprecipitation (IP) 21 Antibodies 8 Antibodies 8 Antibodies 1 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 35 Antibodies 16 Antibodies 14 Antibodies
Immunohistochemistry (IHC) 161 Antibodies 90 Antibodies 83 Antibodies

General

Antigen V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian) (SRC) Antibodies
Epitope N-Term
(75), (34), (30), (26), (26), (24), (19), (15), (14), (13), (11), (8), (6), (6), (5), (5), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
(420), (192), (154), (21), (8), (7), (6), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(371), (73), (1)
Clonality
Polyclonal
Conjugate This SRC antibody is un-conjugated
(19), (15), (15), (14), (13), (13), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1)
Application Western Blotting (WB)
(361), (205), (161), (39), (34), (25), (23), (21), (12), (7), (5), (3), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-SRC Antibody

Target Details SRC Application Details Handling References for anti-SRC Antibody (ABIN2779668) Images
Blocking Peptide Blocking peptide for this product available: ABIN984404
Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSK PASADGHRGP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %, Pig : 90 %, Bovine : 80 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SRC

Target Details SRC

Product Details anti-SRC Antibody Application Details Handling References for anti-SRC Antibody (ABIN2779668) Images back to top
Antigen
Alternative Name SRC (SRC Antibody Abstract)
Background This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 60 kDa
Gene ID 6714
NCBI Accession NM_198291, NP_938033
UniProt P12931
Research Area Signaling
Pathways JAK-STAT Signaling, Neurotrophin Signaling Pathway

Application Details

Product Details anti-SRC Antibody Target Details SRC Handling References for anti-SRC Antibody (ABIN2779668) Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 536 AA

Restrictions For Research Use only

Handling

Product Details anti-SRC Antibody Target Details SRC Application Details References for anti-SRC Antibody (ABIN2779668) Images back to top
Format Liquid
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

References for anti-SRC Antibody (ABIN2779668)

Product Details anti-SRC Antibody Target Details SRC Application Details Handling Images back to top
Background publications

Pechkovsky, Scaffidi, Hackett, Ballard, Shaheen, Thompson, Thannickal, Knight: "Transforming growth factor beta1 induces alphavbeta3 integrin expression in human lung fibroblasts via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway." in: The Journal of biological chemistry, Vol. 283, Issue 19, pp. 12898-908, 2008

Images

Product Details anti-SRC Antibody Target Details SRC Application Details Handling References for anti-SRC Antibody (ABIN2779668) back to top
Supplier Images
Western Blotting (WB) image for anti-SRC antibody (V-Src Sarcoma (Schmidt-Ruppin A-2) Viral Oncogene Homolog (Avian)) (N-Term) (ABIN2779668) WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1...