anti-Rat (Rattus) Filamin A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Filamin A Antibody (supplied by: Log in to see )

Antigen
Filamin A, alpha (FLNA) Antibodies
  • fb98b06
  • wu:fb98b06
  • wu:fd09g03
  • wu:fd49a06
  • flna
  • cb967
  • wu:fd18g06
  • MGC147094
  • CG3937
  • Cher
  • Dmel\\CG3937
  • FLN
  • Fil
  • joy
  • sko
  • ABP-280
  • ABPX
  • CSBS
  • CVD1
  • FLN-A
  • FLN1
  • FMD
  • MNS
  • NHBP
  • OPD
  • OPD1
  • OPD2
  • XLVD
  • XMVD
  • RGD1560614
  • Dilp2
  • F730004A14Rik
  • Fln1
  • filamin-1
  • filamin A, alpha (actin binding protein 280)
  • filamin A, alpha
  • filamin B, like
  • cheerio
  • filamin, alpha
  • flna
  • FLNA
  • flnbl
  • cher
  • Flna
Reactivity
Human, Mouse (Murine), Rat (Rattus)
156
95
94
4
4
3
1
1
1
1
Host
Rabbit
130
22
4
Clonality
Polyclonal
Conjugate
This Filamin A antibody is un-conjugated
6
6
6
4
4
4
4
4
4
4
4
4
4
4
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
75
53
50
43
40
18
16
9
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311942
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.571586 ABIN4311944 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN2878945 IHC (p) ELISA WB Rabbit IgG AA 2121-2170 Log in to see Polyclonal
1 ABIN265421 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1734376 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN800802 IHC (p) HRP Rabbit IgG pSer2523 Log in to see Polyclonal
1 ABIN1711924 IHC (p) HRP Rabbit IgG pSer1459 Log in to see Polyclonal
1 ABIN1712579 IHC (p) HRP Rabbit IgG pSer1084 Log in to see Polyclonal
1 ABIN800795 IHC (p) Biotin Rabbit IgG pSer2523 Log in to see Polyclonal
1 ABIN753907 IHC (p) HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1701562 IHC (p) Biotin Rabbit IgG pSer1084 Log in to see Polyclonal
1 ABIN1700907 IHC (p) Biotin Rabbit IgG pSer1459 Log in to see Polyclonal
1 ABIN800778 IF (p) IHC (p) Rabbit IgG pSer2152 Log in to see Polyclonal
1 ABIN800793 IF (p) IHC (p) Rabbit IgG pSer2523 Log in to see Polyclonal
1 ABIN1715064 IF (p) IHC (p) Rabbit IgG pSer1084 Log in to see Polyclonal
1 ABIN1714409 IF (p) IHC (p) Rabbit IgG pSer1459 Log in to see Polyclonal
1 ABIN753900 IHC (p) Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN753898 IF (p) IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN2891409 IHC (p) WB Rabbit Arg2146 Log in to see Polyclonal
1 ABIN2883781 ELISA IHC (p) WB Rabbit IgG pSer2152 Log in to see Polyclonal
1 ABIN2620976 IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal

General

Antigen Filamin A, alpha (FLNA) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(156), (95), (94), (4), (4), (3), (1), (1), (1), (1)
Host Rabbit
(130), (22), (4)
Clonality
Polyclonal
Conjugate This Filamin A antibody is un-conjugated
(6), (6), (6), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(75), (53), (50), (43), (40), (18), (16), (9), (4), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-Filamin A Antibody

Target Details Filamin A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVT
Isotype IgG

Target Details Filamin A

Product Details anti-Filamin A Antibody Application Details Handling Images back to top
Antigen
Alternative Name Filamin A (FLNA Antibody Abstract)
Background Gene Symbol: FLNA
Gene ID 2316
Research Area Signaling, Microfilaments, Cytoskeleton
Pathways TCR Signaling, Maintenance of Protein Location

Application Details

Product Details anti-Filamin A Antibody Target Details Filamin A Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Filamin A Antibody Target Details Filamin A Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Filamin A Antibody Target Details Filamin A Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Filamin A, alpha (FLNA) antibody (ABIN4311942) Immunohistochemistry-Paraffin: Filamin A Antibody [NBP1-90283] - Staining of human bo...
Western Blotting (WB) image for anti-Filamin A, alpha (FLNA) antibody (ABIN4311942) Western Blot: Filamin A Antibody [NBP1-90283] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunofluorescence (IF) image for anti-Filamin A, alpha (FLNA) antibody (ABIN4311942) Immunocytochemistry/Immunofluorescence: Filamin A Antibody [NBP1-90283] - Staining of...
Western Blotting (WB) image for anti-Filamin A, alpha (FLNA) antibody (ABIN4311942) Western Blot: Filamin A Antibody [NBP1-90283] - Lane 1: Marker [KDa] 250,130,100,70,5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Filamin A, alpha (FLNA) antibody (ABIN4311942) Immunohistochemistry-Paraffin: Filamin A Antibody - Staining of human seminal vesicl...