You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human BAD antibody for Immunocytochemistry

Recommended BAD Antibody (supplied by: Log in to see )

BCL2-Associated Agonist of Cell Death (BAD) Antibodies
  • bad
  • fa01b12
  • wu:fa01b12
  • wu:fa96d04
  • BAD
  • BBC2
  • BCL2L8
  • AI325008
  • Bbc2
  • BCL2-antagonist of cell death b
  • BCL2-associated agonist of cell death
  • badb
  • BAD
  • Bad
This BAD antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4282868
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4282853 ICC IF IHC IHC (p) WB Rabbit pSer155 Log in to see Polyclonal
1 ABIN4282859 ICC IF IHC IHC (p) IP WB Rabbit Log in to see Polyclonal
1 ABIN4902999 FACS ICC IHC IP WB Rabbit IgG Log in to see
1 ABIN4282858 ICC IF IHC IHC (p) IP WB Rabbit Log in to see Polyclonal
1 ABIN5013228 ICC IHC IP WB Rabbit IgG AA 1-168 Log in to see Polyclonal

Similar anti-BAD Antibodies

Application / Reactivity Human
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 250 Antibodies
ELISA 383 Antibodies
Enzyme Immunoassay (EIA) 13 Antibodies
Flow Cytometry (FACS) 10 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 3 Antibodies
Immunocytochemistry (ICC) 6 Antibodies
Immunofluorescence (IF) 30 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 66 Antibodies
Immunohistochemistry (IHC) 281 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 2 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 98 Antibodies
Immunoprecipitation (IP) 38 Antibodies
Immunostaining (ISt) 1 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies


Antigen BCL2-Associated Agonist of Cell Death (BAD) Antibodies
Reactivity Human
(793), (449), (277), (17), (15), (7), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(978), (49), (2), (1)
Conjugate This BAD antibody is un-conjugated
(65), (64), (64), (58), (58), (58), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(530), (463), (418), (298), (107), (79), (52), (29), (13), (11), (5), (5), (4), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-BAD Antibody

Target Details BAD Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
Isotype IgG

Target Details BAD

Product Details anti-BAD Antibody Application Details Handling Images back to top
Alternative Name Bad (BAD Antibody Abstract)
Background Gene Symbol: BAD
Gene ID 572
Research Area Apoptosis/Necrosis, Cancer
Pathways MAPK Signaling, PI3K-Akt Signaling, RTK Signaling, Apoptosis, Fc-epsilon Receptor Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis

Application Details

Product Details anti-BAD Antibody Target Details BAD Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-BAD Antibody Target Details BAD Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-BAD Antibody Target Details BAD Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-BAD antibody (BCL2-Associated Agonist of Cell Death) (ABIN4282868) Immunohistochemistry-Paraffin: Bad Antibody [NBP1-88698] - Staining of human kidney s...
Immunofluorescence (IF) image for anti-BAD antibody (BCL2-Associated Agonist of Cell Death) (ABIN4282868) Immunocytochemistry/Immunofluorescence: Bad Antibody [NBP1-88698] - Staining of human...
Western Blotting (WB) image for anti-BAD antibody (BCL2-Associated Agonist of Cell Death) (ABIN4282868) Western Blot: Bad Antibody [NBP1-88698] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, ...