anti-Human ELK1 antibody for Immunocytochemistry

Recommended ELK1 Antibody (supplied by: Log in to see )

Antigen
ELK1, Member of ETS Oncogene Family (ELK1) Antibodies
  • Elk-1
  • BEC2
  • ELK1
  • Kv12.3
  • ETS domain-containing protein Elk-1
  • ELK1, member of ETS oncogene family
  • potassium voltage-gated channel, subfamily H (eag-related), member 4
  • Tsp_02690
  • ELK1
  • Elk1
  • elk1
  • KCNH4
Reactivity
Human
352
207
195
23
18
14
13
12
7
6
3
3
3
3
2
1
1
Host
Rabbit
278
77
Clonality
Polyclonal
Conjugate
This ELK1 antibody is un-conjugated
7
7
7
6
6
5
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
245
163
125
48
42
40
30
7
3
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076512
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4307742 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2620332 ICC IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal

Similar anti-ELK1 Antibodies

Application / Reactivity Human
Dot Blot (DB) 1 Antibodies
ELISA 125 Antibodies
Enzyme Immunoassay (EIA) 7 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 31 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 40 Antibodies
Immunohistochemistry (IHC) 163 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 48 Antibodies
Immunoprecipitation (IP) 42 Antibodies
Intracellular Staining (ICS) 3 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies
Western Blotting (WB) 240 Antibodies

General

Antigen ELK1, Member of ETS Oncogene Family (ELK1) Antibodies
Reactivity Human
(352), (207), (195), (23), (18), (14), (13), (12), (7), (6), (3), (3), (3), (3), (2), (1), (1)
Host Rabbit
(278), (77)
Clonality
Polyclonal
Conjugate This ELK1 antibody is un-conjugated
(7), (7), (7), (6), (6), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(245), (163), (125), (48), (42), (40), (30), (7), (3), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-ELK1 Antibody

Target Details ELK1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL
Isotype IgG

Target Details ELK1

Product Details anti-ELK1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Elk-1 (ELK1 Antibody Abstract)
Background Gene Symbol: ELK1
Gene ID 2002
Pathways MAPK Signaling, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-ELK1 Antibody Target Details ELK1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ELK1 Antibody Target Details ELK1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ELK1 Antibody Target Details ELK1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-ELK1 antibody (ELK1, Member of ETS Oncogene Family) (ABIN5076512) Immunocytochemistry/Immunofluorescence: Elk-1 Antibody - Staining of human cell line...