You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) MAP2K1 antibody for Immunofluorescence

Recommended MAP2K1 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) Antibodies
  • Mek1
  • CFC3
  • MAPKK1
  • MEK1
  • MKK1
  • PRKMK1
  • MEKK1
  • Prkmk1
  • mek-2
  • si:ch211-242m18.2
  • wu:fj56a12
  • wu:fj61b01
  • zgc:56557
  • ATMEK1
  • F20B18.180
  • F20B18_180
  • MAP kinase/ ERK kinase 1
  • MEK
  • mitogen activated protein kinase kinase 1
  • mitogen-activated protein kinase kinase 1
  • Map2k1
  • MAP2K1
  • map2k1
  • MEK1
Human, Rat (Rattus)
This MAP2K1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333486
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.761539 ABIN1870339 IF IHC WB Rabbit IgG pSer221 Log in to see Polyclonal
11.761539 ABIN615073 IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal
11.761539 ABIN2424909 IF IHC WB Rabbit IgG pSer221 Log in to see Polyclonal
1 ABIN196888 IF IHC (p) WB Rabbit pSer221, pSer222 Log in to see Polyclonal 5
1 ABIN362168 IF IHC WB Rabbit IgG pSer221 Log in to see Polyclonal 6
1 ABIN498700 IF IHC (p) WB Rabbit pThr292 Log in to see Polyclonal
1 ABIN3182065 ELISA IF IHC WB Rabbit IgG pThr292 Log in to see Polyclonal
1 ABIN197430 IF IHC (p) WB Rabbit Ser217 Log in to see Polyclonal
1 ABIN4333491 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN2671146 IF IHC WB Mouse IgG1 Log in to see OTIE1 1
1 ABIN1736705 IF IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN4333482 ICC IF IHC IHC (p) WB Rabbit pThr292 Log in to see Polyclonal
1 ABIN1842366 IF IHC WB Rabbit IgG pSer221 Log in to see Polyclonal
1 ABIN1842521 IF IHC WB Rabbit IgG pSer217 Log in to see Polyclonal
1 ABIN2987553 ICC IF IHC WB Rabbit IgG pSer221 Log in to see Polyclonal
1 ABIN2670913 IF IHC WB Mouse IgG2a Log in to see OTI1E5
1 ABIN2670946 IF IHC WB Mouse IgG2a Log in to see OTI2B2
1 ABIN2670933 IF IHC WB Mouse IgG2a Log in to see OTI3B4
1 ABIN2671150 IF IHC WB Mouse IgG2b Log in to see OTI1B4
1 ABIN2671153 IF IHC WB Mouse IgG1 Log in to see OTI7E2

Top referenced anti-MAP2K1 antibody for Immunofluorescence

Similar anti-MAP2K1 Antibodies

Application / Reactivity Rat (Rattus) Human
BioImaging (BI) 2 Antibodies 2 Antibodies
ELISA 46 Antibodies 155 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies 6 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunofluorescence (IF) 51 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 65 Antibodies
Immunohistochemistry (IHC) 112 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 44 Antibodies
Immunoprecipitation (IP) 8 Antibodies
Intracellular Staining (ICS) 3 Antibodies
Simple Western (SimWes) 1 Antibodies
Western Blotting (WB) 208 Antibodies
Dot Blot (DB) 23 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunochromatography (IC) 2 Antibodies


Antigen Mitogen-Activated Protein Kinase Kinase 1 (MAP2K1) Antibodies
Reactivity Human, Rat (Rattus)
(622), (337), (292), (60), (38), (24), (15), (14), (13), (6), (4), (4), (4), (2), (2)
Host Rabbit
(508), (125), (2), (2), (1)
Conjugate This MAP2K1 antibody is un-conjugated
(14), (14), (14), (11), (9), (8), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(458), (211), (158), (117), (94), (78), (24), (23), (15), (10), (9), (6), (6), (2), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-MAP2K1 Antibody

Target Details MAP2K1 Application Details Handling References for anti-MAP2K1 Antibody (ABIN4333486) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
Isotype IgG

Target Details MAP2K1

Product Details anti-MAP2K1 Antibody Application Details Handling References for anti-MAP2K1 Antibody (ABIN4333486) Images back to top
Alternative Name MEK1 (MAP2K1 Antibody Abstract)
Background Gene Symbol: MAP2K1
Gene ID 5604
Research Area Signaling, Tyrosine Kinases
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Handling References for anti-MAP2K1 Antibody (ABIN4333486) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details References for anti-MAP2K1 Antibody (ABIN4333486) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MAP2K1 Antibody (ABIN4333486)

Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details Handling Images back to top
Product cited in:

Pénzváltó, Lánczky, Lénárt, Meggyesházi, Krenács, Szoboszlai, Denkert, Pete, Győrffy: "MEK1 is associated with carboplatin resistance and is a prognostic biomarker in epithelial ovarian cancer." in: BMC cancer, Vol. 14, pp. 837, 2014 (Sample species: Human). Further details: Immunohistochemistry


Product Details anti-MAP2K1 Antibody Target Details MAP2K1 Application Details Handling References for anti-MAP2K1 Antibody (ABIN4333486) back to top
Supplier Images
Western Blotting (WB) image for anti-MAP2K1 antibody (Mitogen-Activated Protein Kinase Kinase 1) (ABIN4333486) Western Blot: MEK1 Antibody [NBP1-87790] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Western Blotting (WB) image for anti-MAP2K1 antibody (Mitogen-Activated Protein Kinase Kinase 1) (ABIN4333486) Western Blot: MEK1 Antibody [NBP1-87790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-MAP2K1 antibody (Mitogen-Activated Protein Kinase Kinase 1) (ABIN4333486) Immunocytochemistry/Immunofluorescence: MEK1 Antibody [NBP1-87790] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAP2K1 antibody (Mitogen-Activated Protein Kinase Kinase 1) (ABIN4333486) Immunohistochemistry-Paraffin: MEK1 Antibody [NBP1-87790] - Staining of human hippoca...