You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAP2K5 antibody for Immunocytochemistry

Recommended MAP2K5 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase Kinase 5 (MAP2K5) Antibodies
  • Mek5
  • HsT17454
  • MAPKK5
  • MEK5
  • PRKMK5
  • AI324775
  • AI428457
  • Mapkk5
  • Prkmk5
  • fb73f02
  • wu:fb73f02
  • zgc:172137
  • ATMEK5
  • ATMKK5
  • MAP kinase kinase 5
  • MAP2K_A
  • mitogen activated protein kinase kinase 5
  • mitogen-activated protein kinase kinase 5
  • Map2k5
  • MAP2K5
  • map2k5
  • MKK5
This MAP2K5 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333506
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2970174 ICC IF IHC WB Rabbit IgG Log in to see Polyclonal

Similar anti-MAP2K5 Antibodies

Application / Reactivity Human
ELISA 46 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 22 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 54 Antibodies
Immunohistochemistry (IHC) 29 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 23 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies
Western Blotting (WB) 95 Antibodies


Antigen Mitogen-Activated Protein Kinase Kinase 5 (MAP2K5) Antibodies
Reactivity Human
(153), (76), (75), (11), (9), (7), (6), (5), (3), (3), (3), (3), (2), (2), (1)
Host Rabbit
(154), (16)
Conjugate This MAP2K5 antibody is un-conjugated
(9), (9), (9), (5), (5), (5), (5), (5), (5), (5), (5), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(110), (54), (47), (28), (22), (21), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-MAP2K5 Antibody

Target Details MAP2K5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNA
Isotype IgG

Target Details MAP2K5

Product Details anti-MAP2K5 Antibody Application Details Handling Images back to top
Alternative Name MEK5 (MAP2K5 Antibody Abstract)
Background Gene Symbol: MAP2K5
Gene ID 5607
Research Area Kinases/Phosphatases, Cancer
Pathways MAPK Signaling, Neurotrophin Signaling Pathway

Application Details

Product Details anti-MAP2K5 Antibody Target Details MAP2K5 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP2K5 Antibody Target Details MAP2K5 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MAP2K5 Antibody Target Details MAP2K5 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-MAP2K5 antibody (Mitogen-Activated Protein Kinase Kinase 5) (ABIN4333506) Western Blot: MEK5 Antibody [NBP1-89655] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAP2K5 antibody (Mitogen-Activated Protein Kinase Kinase 5) (ABIN4333506) Immunohistochemistry-Paraffin: MEK5 Antibody [NBP1-89655] - Staining of human skeleta...
Immunofluorescence (IF) image for anti-MAP2K5 antibody (Mitogen-Activated Protein Kinase Kinase 5) (ABIN4333506) Immunocytochemistry/Immunofluorescence: MEK5 Antibody [NBP1-89655] - Staining of huma...