You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) MAP2K6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP2K6 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Kinase 6 (MAP2K6) Antibodies
  • MAPKK6
  • MEK6
  • MKK6
  • PRKMK6
  • SAPKK-3
  • SAPKK3
  • Mkk6
  • Prkmk6
  • ANQ1
  • ARABIDOPSIS NQK1
  • ARABIDOPSIS THALIANA MAP KINASE KINASE 6
  • ATMKK6
  • MAP kinase kinase 6
  • MIK19.2
  • MIK19_2
  • MKK3
  • map2k3
  • zMKK3
  • mitogen-activated protein kinase kinase 6
  • MAP2K6
  • Map2k6
  • MKK6
  • map2k6
Reactivity
Human, Mouse (Murine), Rat (Rattus)
181
108
82
4
2
2
Host
Rabbit
165
37
2
Clonality
Polyclonal
Conjugate
This MAP2K6 antibody is un-conjugated
5
5
5
3
3
3
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
166
77
75
46
28
23
19
14
10
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4334818
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.398621 ABIN4334813 IHC IHC (p) WB Rabbit Log in to see Polyclonal
11.398621 ABIN743903 IF (p) IHC (p) WB Rabbit IgG pSer202 Log in to see Polyclonal
1 ABIN196864 IF IHC (p) WB Rabbit pSer207 Log in to see Polyclonal 2
1 ABIN272204 IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN681568 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 1
1 ABIN4334815 ICC IF IHC IHC (p) WB Rabbit pSer207 Log in to see Polyclonal
1 ABIN743897 IHC (p) WB HRP Rabbit IgG pSer207 Log in to see Polyclonal
1 ABIN1736713 IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN681577 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN446647 IHC (p) IP IHC WB Rabbit Log in to see Polyclonal
1 ABIN743890 IHC (p) WB Biotin Rabbit IgG pSer207 Log in to see Polyclonal
1 ABIN681570 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN4334814 ICC IF IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN743888 IF (p) IHC (p) WB Rabbit IgG pSer207 Log in to see Polyclonal

Top referenced anti-MAP2K6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-MAP2K6 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 17 Antibodies 41 Antibodies
Immunochromatography (IC) 1 Antibodies 1 Antibodies
Immunocytochemistry (ICC) 6 Antibodies 9 Antibodies
Immunofluorescence (IF) 24 Antibodies 15 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 23 Antibodies 23 Antibodies
Immunohistochemistry (IHC) 42 Antibodies 34 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 15 Antibodies 22 Antibodies
Immunoprecipitation (IP) 4 Antibodies 4 Antibodies
Western Blotting (WB) 59 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Flow Cytometry (FACS) 8 Antibodies

General

Antigen Mitogen-Activated Protein Kinase Kinase 6 (MAP2K6) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(181), (108), (82), (4), (2), (2)
Host Rabbit
(165), (37), (2)
Clonality
Polyclonal
Conjugate This MAP2K6 antibody is un-conjugated
(5), (5), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(166), (77), (75), (46), (28), (23), (19), (14), (10), (3), (2), (1)
Supplier Log in to see

Product Details anti-MAP2K6 Antibody

Target Details MAP2K6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
Isotype IgG

Target Details MAP2K6

Product Details anti-MAP2K6 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MKK6/MEK6 (MAP2K6 Antibody Abstract)
Background Gene Symbol: MAP2K6
Gene ID 5608
Pathways MAPK Signaling, TLR Signaling

Application Details

Product Details anti-MAP2K6 Antibody Target Details MAP2K6 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP2K6 Antibody Target Details MAP2K6 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MAP2K6 Antibody Target Details MAP2K6 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-MAP2K6 antibody (Mitogen-Activated Protein Kinase Kinase 6) (ABIN4334818) Western Blot: MKK6/MEK6 Antibody [NBP1-87791] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Western Blotting (WB) image for anti-MAP2K6 antibody (Mitogen-Activated Protein Kinase Kinase 6) (ABIN4334818) Western Blot: MKK6/MEK6 Antibody [NBP1-87791] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAP2K6 antibody (Mitogen-Activated Protein Kinase Kinase 6) (ABIN4334818) Immunohistochemistry-Paraffin: MKK6/MEK6 Antibody [NBP1-87791] - Staining of human pa...