anti-Human MAP4K3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP4K3 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase Kinase Kinase Kinase 3 (MAP4K3) Antibodies
  • GLK
  • MEKKK 3
  • MEKKK3
  • RAB8IPL1
  • 4833416M01Rik
  • 4833416M07Rik
  • 9530052P13Rik
  • Glk
  • mitogen-activated protein kinase kinase kinase kinase 3
  • MAP4K3
  • Map4k3
This MAP4K3 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332663
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
14.079243 ABIN4332664 FACS IHC (p) WB Rabbit Log in to see Polyclonal
14.079243 ABIN4911758 IHC (p) WB Mouse IgM kappa Log in to see 219CT8-3-1
1 ABIN360428 EIA IHC (p) WB Rabbit Ig C-Term Log in to see Polyclonal 1
1 ABIN653817 FACS IHC (p) WB Rabbit Ig Log in to see Polyclonal 1
1 ABIN5556276 FACS IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN658364 FACS IHC (p) WB Rabbit Ig AA 501-529, Center Log in to see Polyclonal
1 ABIN1911831 FACS IHC (p) WB Rabbit AA 501-529 Log in to see Polyclonal
1 ABIN5536178 FACS IHC (p) WB Rabbit Ig Fraction AA 501-529 Log in to see Polyclonal
1 ABIN5536177 FACS IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN5583052 IHC (p) WB Mouse IgM kappa Log in to see 219CT8-3-1
1 ABIN1841497 IHC (p) WB Rabbit AA 423-453 Log in to see Polyclonal
1 ABIN1811265 FACS IHC (p) WB Rabbit AA 31-283 Log in to see Polyclonal
1 ABIN2963389 FACS IHC (p) WB Rabbit AA 500-529, Internal Region Log in to see Polyclonal


Antigen Mitogen-Activated Protein Kinase Kinase Kinase Kinase 3 (MAP4K3) Antibodies
Reactivity Human
(79), (26), (15)
Host Rabbit
(67), (12)
Conjugate This MAP4K3 antibody is un-conjugated
(6), (5), (5), (5), (5), (5)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(75), (46), (42), (36), (13), (2), (1), (1)
Supplier Log in to see

Product Details anti-MAP4K3 Antibody

Target Details MAP4K3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVP
Isotype IgG

Target Details MAP4K3

Product Details anti-MAP4K3 Antibody Application Details Handling Images back to top
Alternative Name MAP4K3 (MAP4K3 Antibody Abstract)
Background Gene Symbol: MAP4K3
Gene ID 8491
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-MAP4K3 Antibody Target Details MAP4K3 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP4K3 Antibody Target Details MAP4K3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MAP4K3 Antibody Target Details MAP4K3 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase Kinase 3 (MAP4K3) antibody (ABIN4332663) Immunocytochemistry/Immunofluorescence: MAP4K3 Antibody [NBP1-81824] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase Kinase 3 (MAP4K3) antibody (ABIN4332663) Immunohistochemistry-Paraffin: MAP4K3 Antibody [NBP1-81824] - Staining of human skele...