You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAPK12 antibody for Immunocytochemistry

Recommended MAPK12 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase 12 (MAPK12) Antibodies
  • ATMPK12
  • MAPK12
  • T3F17.28
  • mitogen-activated protein kinase 12
  • MGC160082
  • si:dkey-14d8.5
  • erk6
  • etID309866.18
  • mapk12
  • sapk3
  • wu:fa05c12
  • zgc:101695
  • ERK3
  • ERK6
  • P38GAMMA
  • PRKM12
  • SAPK-3
  • SAPK3
  • AW123708
  • Erk6
  • P38gamma
  • Prkm12
  • Sapk3
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 12b
  • mitogen-activated protein kinase 12a
  • MPK12
  • MAPK12
  • mapk12b
  • mapk12a
  • Mapk12
This MAPK12 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4342707
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1869087 ICC IHC IP WB Rabbit IgG AA 27-311 Log in to see Polyclonal

Similar anti-MAPK12 Antibodies

Application / Reactivity Human
ELISA 50 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 9 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 17 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 44 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 14 Antibodies
Immunoprecipitation (IP) 7 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 101 Antibodies


Antigen Mitogen-Activated Protein Kinase 12 (MAPK12) Antibodies
Reactivity Human
(106), (47), (18), (5), (5), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Host Rabbit
(81), (27), (2)
Conjugate This MAPK12 antibody is un-conjugated
(4), (4), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(104), (50), (43), (16), (13), (9), (7), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-MAPK12 Antibody

Target Details MAPK12 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV

Target Details MAPK12

Product Details anti-MAPK12 Antibody Application Details Handling Images back to top
Alternative Name p38 gamma/sapk3 (MAPK12 Antibody Abstract)
Background Gene Symbol: MAPK12
Gene ID 6300
UniProt P53778
Pathways MAPK Signaling, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C

Application Details

Product Details anti-MAPK12 Antibody Target Details MAPK12 Handling Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAPK12 Antibody Target Details MAPK12 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MAPK12 Antibody Target Details MAPK12 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-MAPK12 antibody (Mitogen-Activated Protein Kinase 12) (ABIN4342707) Immunohistochemistry: p38 gamma/SAPK3 Antibody [NBP2-38729] - Staining of human heart...
Western Blotting (WB) image for anti-MAPK12 antibody (Mitogen-Activated Protein Kinase 12) (ABIN4342707) Western Blot: p38 gamma/SAPK3 Antibody [NBP2-38729] - Lane 1: Marker [kDa] 250, 130, ...
Immunofluorescence (IF) image for anti-MAPK12 antibody (Mitogen-Activated Protein Kinase 12) (ABIN4342707) Immunocytochemistry/Immunofluorescence: p38 gamma/SAPK3 Antibody [NBP2-38729] - Immun...