You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rabbit MAPK3 antibody for Immunohistochemistry

Recommended MAPK3 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ATMAPK3
  • ATMPK3
  • T6D9.4
  • mitogen-activated protein kinase 3
  • ERK1
  • fi06b09
  • wu:fi06b09
  • zERK1
  • ERK-1
  • ERT2
  • HS44KDAP
  • HUMKER1A
  • P44ERK1
  • P44MAPK
  • PRKM3
  • p44-ERK1
  • p44-MAPK
  • Erk-1
  • Erk1
  • Ert2
  • Esrk1
  • Mnk1
  • Mtap2k
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • MAPK1
  • MNK1
  • Tb08.10J17.940
  • mitogen-activated protein kinase 3
  • MAP kinase-like orf; aka CEK1; one of two protein kinase genes similar to S. cerevisiae MAP kinases FUS3 (YBL016W) and KSS1 (YGR040W) involved in pheromone signal transduction
  • mitogen activated protein kinase 3
  • MPK3
  • MAPK3
  • ERK1
  • Mapk3
  • mapk3
  • Tb927.8.3550
  • Tc00.1047053509475.10
Epitope
AA 336-367
47
46
39
33
21
21
19
16
15
14
14
8
8
5
5
4
4
4
4
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
461
257
191
35
25
24
24
23
19
19
13
12
11
9
9
7
4
3
3
2
2
2
1
1
1
1
1
Host
Rabbit
309
153
20
2
1
Clonality
Polyclonal
Conjugate
This MAPK3 antibody is un-conjugated
23
23
21
16
12
12
6
6
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
381
176
159
97
75
54
47
46
39
16
13
9
7
4
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN351563
$ 566.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN966747 IHC Log in to see Polyclonal

Similar anti-MAPK3 Antibodies

Application / Reactivity Mouse (Murine) Rat (Rattus) Rabbit Hamster
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies 5 Antibodies
Western Blotting (WB) 195 Antibodies 129 Antibodies 7 Antibodies 4 Antibodies
Immunoprecipitation (IP) 29 Antibodies 29 Antibodies 5 Antibodies 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 35 Antibodies 34 Antibodies 4 Antibodies
Immunohistochemistry (IHC) 79 Antibodies 94 Antibodies 2 Antibodies 3 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 39 Antibodies

General

Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope AA 336-367
(47), (46), (39), (33), (21), (21), (19), (16), (15), (14), (14), (8), (8), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
(461), (257), (191), (35), (25), (24), (24), (23), (19), (19), (13), (12), (11), (9), (9), (7), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(309), (153), (20), (2), (1)
Clonality
Polyclonal
Conjugate This MAPK3 antibody is un-conjugated
(23), (23), (21), (16), (12), (12), (6), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blotting (WB)
(381), (176), (159), (97), (75), (54), (47), (46), (39), (16), (13), (9), (7), (4), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Protein A purified
Immunogen A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.
Restrictions For Research Use only

Handling

Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer Liquid
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Long term: -20°C
Short term: +4°C. Avoid repeat freeze-thaw cycles.