You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) MAPK3 antibody for Functional Studies

Recommended MAPK3 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ATMAPK3
  • ATMPK3
  • Erk-1
  • ERK-1
  • Erk1
  • ERK1
  • ERT2
  • Ert2
  • Esrk1
  • fi06b09
  • HS44KDAP
  • HUMKER1A
  • MAPK1
  • mitogen-activated protein kinase 3
  • MNK1
  • Mnk1
  • Mtap2k
  • p44
  • p44-ERK1
  • p44-MAPK
  • p44erk1
  • P44ERK1
  • p44mapk
  • P44MAPK
  • PRKM3
  • Prkm3
  • T6D9.4
  • Tb08.10J17.940
  • wu:fi06b09
  • zERK1
Epitope
C-Term
57
44
42
39
27
20
20
15
14
13
9
9
8
8
5
5
5
4
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Rat (Rattus)
455
217
155
27
23
22
19
19
16
13
7
6
4
4
4
4
3
3
2
2
2
1
1
Host
Rabbit
317
151
21
2
1
Clonality
Polyclonal
Conjugate
This MAPK3 antibody is un-conjugated
23
23
21
16
12
12
6
6
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
384
184
151
96
67
57
49
33
30
18
10
6
4
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN199418
$ 837.83
Plus shipping costs $45.00

Similar anti-MAPK3 Antibodies

Application / Reactivity Rat (Rattus)
Dot Blot (DB) 1 Antibodies
ELISA 26 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 23 Antibodies
Functional Studies (Func) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 26 Antibodies
Immunofluorescence (IF) 40 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 33 Antibodies
Immunohistochemistry (IHC) 62 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 5 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 28 Antibodies
Immunoprecipitation (IP) 22 Antibodies
Western Blotting (WB) 106 Antibodies

General

Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope C-Term
(57), (44), (42), (39), (27), (20), (20), (15), (14), (13), (9), (9), (8), (8), (5), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Rat (Rattus)
(455), (217), (155), (27), (23), (22), (19), (19), (16), (13), (7), (6), (4), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1)
Host Rabbit
(317), (151), (21), (2), (1)
Clonality
Polyclonal
Conjugate This MAPK3 antibody is un-conjugated
(23), (23), (21), (16), (12), (12), (6), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
(384), (184), (151), (96), (67), (57), (49), (33), (30), (18), (10), (6), (4), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
Cross-Reactivity Chicken, Human, Mouse (Murine)
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Immunoaffinity Chromatography
Immunogen Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled).
Isotype IgG

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Standard Gene Symbol: MAPK3, Gene Family: Protein Kinase, Gene Subfamily: MAPK, Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Func, IP, WB (0.1 - 2 µg/mL)
Restrictions For Research Use only

Handling

Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Buffer 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 0.1 mM EDTA.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C/-20 °C
Storage Comment Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.