anti-Rat (Rattus) MAPK3 antibody for Functional Studies

Recommended MAPK3 Antibody (supplied by: Log in to see )

Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
  • ERK-1
  • ERK1
  • ERT2
  • HS44KDAP
  • P44ERK1
  • P44MAPK
  • PRKM3
  • p44-ERK1
  • p44-MAPK
  • Erk-1
  • Erk1
  • Ert2
  • Esrk1
  • Mnk1
  • Mtap2k
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • fi06b09
  • wu:fi06b09
  • zERK1
  • Tb08.10J17.940
  • erk6
  • etID309866.18
  • mapk12
  • sapk3
  • wu:fa05c12
  • zgc:101695
  • MAPK1
  • MNK1
  • ATMPK3
  • T6D9.4
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 3
  • mitogen-activated protein kinase 12a
  • mitogen activated protein kinase 3
  • mitogen-activated serine/threonine-protein kinase
  • MAPK3
  • Mapk3
  • mapk3
  • Tc00.1047053509475.10
  • Tb927.8.3550
  • mapk12a
  • CEK1
  • MPK3
AA 372-406
Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
This MAPK3 antibody is un-conjugated
Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN199418
$ 925.83
Plus shipping costs $45.00


Antigen Mitogen-Activated Protein Kinase 3 (MAPK3) Antibodies
Epitope AA 372-406
(49), (48), (46), (39), (21), (21), (19), (16), (15), (14), (9), (8), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Hamster, Mouse (Murine), Rabbit, Rat (Rattus)
(483), (259), (194), (35), (26), (24), (24), (23), (20), (20), (13), (12), (11), (9), (9), (6), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(321), (159), (20), (6), (1)
Conjugate This MAPK3 antibody is un-conjugated
(26), (24), (22), (16), (12), (12), (6), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Functional Studies (Func), Immunoprecipitation (IP), Western Blotting (WB)
(404), (182), (162), (102), (86), (56), (56), (47), (39), (16), (13), (8), (7), (4), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MAPK3 Antibody

Target Details MAPK3 Application Details Handling Images
Specificity Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
Predicted Reactivity Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
Purification Immunoaffinity purified
Immunogen Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated
Isotype IgG

Target Details MAPK3

Product Details anti-MAPK3 Antibody Application Details Handling Images back to top
Alternative Name MAPK3 / ERK1 (MAPK3 Antibody Abstract)
Background Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Gene ID 5595
UniProt P27361
Pathways MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals

Application Details

Product Details anti-MAPK3 Antibody Target Details MAPK3 Handling Images back to top
Application Notes Approved: Func, IP, WB (0.1 - 2 μg/mL)

Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Restrictions For Research Use only


Product Details anti-MAPK3 Antibody Target Details MAPK3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Long term: -20°C
Short term: +4°C. Avoid repeat freeze-thaw cycles.