anti-Rat (Rattus) MAPKAP Kinase 5 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAPKAP Kinase 5 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) Antibodies
  • MAPKAPK5
  • MK5
  • PRAK
  • MAPKAP-K5
  • MK-5
  • mitogen-activated protein kinase-activated protein kinase 5
  • MAP kinase-activated protein kinase 5
  • MAPKAPK5
  • mapkapk5
  • Mapkapk5
Reactivity
Human, Mouse (Murine), Rat (Rattus)
160
79
14
8
7
7
3
3
3
3
3
2
2
Host
Rabbit
105
47
24
Clonality
Polyclonal
Conjugate
This MAPKAP Kinase 5 antibody is un-conjugated
7
7
7
6
6
6
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
151
87
39
22
14
13
10
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347179
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1804776 IHC (p) ELISA WB Goat AA 306-318 Log in to see Polyclonal
1 ABIN1804778 IHC (p) ELISA WB Goat AA 192-206 Log in to see Polyclonal
1 ABIN754378 IF (p) IHC (p) WB Rabbit IgG AA 100-150 Log in to see Polyclonal
1 ABIN2625193 IF IHC (p) IP Rabbit IgG AA 250-300 Log in to see Polyclonal
1 ABIN2625194 IF IHC (p) Rabbit IgG AA 250-300 Log in to see Polyclonal
1 ABIN5541351 EIA IHC (p) IP WB Goat Internal Region Log in to see Polyclonal
1 ABIN5541352 EIA IHC (p) IP WB Goat AA 192-206, Internal Region Log in to see Polyclonal

General

Antigen Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(160), (79), (14), (8), (7), (7), (3), (3), (3), (3), (3), (2), (2)
Host Rabbit
(105), (47), (24)
Clonality
Polyclonal
Conjugate This MAPKAP Kinase 5 antibody is un-conjugated
(7), (7), (7), (6), (6), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(151), (87), (39), (22), (14), (13), (10), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-MAPKAP Kinase 5 Antibody

Target Details MAPKAP Kinase 5 Application Details Handling ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH
Isotype IgG

Target Details MAPKAP Kinase 5

Product Details anti-MAPKAP Kinase 5 Antibody Application Details Handling ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179) Images back to top
Antigen
Alternative Name PRAK (MAPKAPK5 Antibody Abstract)
Background Gene Symbol: MAPKAPK5
Gene ID 8550
Research Area Cancer
Pathways MAPK Signaling

Application Details

Product Details anti-MAPKAP Kinase 5 Antibody Target Details MAPKAP Kinase 5 Handling ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAPKAP Kinase 5 Antibody Target Details MAPKAP Kinase 5 Application Details ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179)

Product Details anti-MAPKAP Kinase 5 Antibody Target Details MAPKAP Kinase 5 Application Details Handling Images back to top
Product cited in:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013

Images

Product Details anti-MAPKAP Kinase 5 Antibody Target Details MAPKAP Kinase 5 Application Details Handling ProductDetails: References for anti-MAPKAP Kinase 5 antibody (ABIN4347179) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) antibody (ABIN4347179) Immunocytochemistry/Immunofluorescence: PRAK Antibody [NBP1-87231] - Staining of huma...
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) antibody (ABIN4347179) Western Blot: PRAK Antibody [NBP1-87231] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) antibody (ABIN4347179) Immunohistochemistry-Paraffin: PRAK Antibody [NBP1-87231] - Staining of human stomach...
Western Blotting (WB) image for anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) antibody (ABIN4347179) Western Blot: PRAK Antibody [NBP1-87231] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase-Activated Protein Kinase 5 (MAPKAPK5) antibody (ABIN4347179) Immunocytochemistry/Immunofluorescence: PRAK Antibody - Immunofluorescent staining o...