anti-Human MKNK1 antibody for Immunocytochemistry

Recommended MKNK1 Antibody (supplied by: Log in to see )

MAP Kinase Interacting serine/threonine Kinase 1 (MKNK1) Antibodies
  • MKNK1
  • zgc:171912
  • MNK1
  • 2410048M24Rik
  • Mnk1
  • ERK1
  • ERT2
  • Erk-1
  • Esrk1
  • MAPK1
  • Prkm3
  • p44
  • p44erk1
  • p44mapk
  • Erk1
  • Ert2
  • Mtap2k
  • MAP kinase interacting serine/threonine kinase 1
  • MAP kinase-interacting serine/threonine kinase 1
  • mitogen activated protein kinase 3
  • mitogen-activated protein kinase 3
  • MKNK1
  • mknk1
  • Mknk1
  • Mapk3
This MKNK1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078147
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN3060163 ICC IF WB Rabbit Log in to see Polyclonal

Similar anti-MKNK1 Antibodies

Application / Reactivity Human
ELISA 97 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 26 Antibodies
Immunohistochemistry (IHC) 31 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 20 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 124 Antibodies


Antigen MAP Kinase Interacting serine/threonine Kinase 1 (MKNK1) Antibodies
Reactivity Human
(134), (61), (47), (5), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(92), (42)
Conjugate This MKNK1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(124), (97), (31), (25), (20), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-MKNK1 Antibody

Target Details MKNK1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS
Isotype IgG

Target Details MKNK1

Product Details anti-MKNK1 Antibody Application Details Handling Images back to top
Alternative Name MNK1 (MKNK1 Antibody Abstract)
Background Gene Symbol: MKNK1
Gene ID 8569
Research Area Signaling
Pathways MAPK Signaling, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-MKNK1 Antibody Target Details MKNK1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MKNK1 Antibody Target Details MKNK1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MKNK1 Antibody Target Details MKNK1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-MKNK1 antibody (MAP Kinase Interacting serine/threonine Kinase 1) (ABIN5078147) Immunocytochemistry/Immunofluorescence: MNK1 Antibody - Staining of human cell line ...