You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MKNK2 antibody for Immunofluorescence

Recommended MKNK2 Antibody (supplied by: Log in to see )

Antigen
MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
  • gprk7
  • mnk2
  • GPRK7
  • MNK2
  • 2010016G11Rik
  • Gprk7
  • Mnk2
  • mknk2
  • wu:fb37e05
  • wz5090
  • MAP kinase interacting serine/threonine kinase 2
  • MAP kinase-interacting serine/threonine kinase 2
  • MAP kinase-interacting serine/threonine kinase 2b
  • MKNK2
  • mknk2
  • Mknk2
  • mknk2b
Reactivity
Human
66
24
7
2
2
2
2
1
1
1
1
1
Host
Rabbit
67
15
Clonality
Polyclonal
Conjugate
This MKNK2 antibody is un-conjugated
7
7
7
7
7
7
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
79
59
7
7
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4335144
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.80984 ABIN516166 IF ELISA WB Mouse IgG2a kappa AA 1-158, full length Log in to see 4F11
11.80984 ABIN5078148 ICC IF Rabbit IgG Log in to see Polyclonal
1 ABIN396365 IF WB Mouse IgG2a kappa AA 1-159 Log in to see 4F11
1 ABIN1828036 IF ELISA WB Mouse IgG2a, kappa AA 1-158 Log in to see 4F11
1 ABIN2475714 IF WB Mouse IgG2a AA 1-159 Log in to see 4F11
1 ABIN2588213 IF ELISA WB Mouse IgG2a AA 1-159 Log in to see
1 ABIN2306432 IF ELISA WB Mouse IgG2a kappa AA 1-158 Log in to see 4F11

Similar anti-MKNK2 Antibodies

Application / Reactivity Human
ELISA 45 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunofluorescence (IF) 8 Antibodies
Immunohistochemistry (IHC) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 65 Antibodies

General

Antigen MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
Reactivity Human
(66), (24), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(67), (15)
Clonality
Polyclonal
Conjugate This MKNK2 antibody is un-conjugated
(7), (7), (7), (7), (7), (7)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(79), (59), (7), (7), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MKNK2 Antibody

Target Details MKNK2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQE
Isotype IgG

Target Details MKNK2

Product Details anti-MKNK2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MNK2 (MKNK2 Antibody Abstract)
Background Gene Symbol: MKNK2
Gene ID 2872
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-MKNK2 Antibody Target Details MKNK2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Immunocytochemistry/Immunofluorescence: MNK2 Antibody [NBP1-92129] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Immunohistochemistry-Paraffin: MNK2 Antibody [NBP1-92129] - Staining of human gall bl...
Western Blotting (WB) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Western Blot: MNK2 Antibody [NBP1-92129] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...