anti-Human MKNK2 antibody for Immunofluorescence

Recommended MKNK2 Antibody (supplied by: Log in to see )

MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
  • gprk7
  • mnk2
  • GPRK7
  • MNK2
  • 2010016G11Rik
  • Gprk7
  • Mnk2
  • mknk2
  • wu:fb37e05
  • wz5090
  • MAP kinase interacting serine/threonine kinase 2
  • MAP kinase interacting serine/threonine kinase 2 L homeolog
  • MAP kinase-interacting serine/threonine kinase 2
  • MAP kinase interacting serine/threonine kinase 2b
  • MKNK2
  • mknk2
  • mknk2.L
  • Mknk2
  • mknk2b
This MKNK2 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078148
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.68828 ABIN4335144 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
11.68828 ABIN516166 IF ELISA WB Mouse IgG2a kappa AA 1-158, full length Log in to see 4F11
1 ABIN396365 IF WB Mouse IgG2a kappa AA 1-159 Log in to see 4F11
1 ABIN2475714 IF WB Mouse IgG2a AA 1-159 Log in to see 4F11
1 ABIN1828036 IF ELISA WB Mouse IgG2a, kappa AA 1-158 Log in to see 4F11
1 ABIN2588213 IF ELISA WB Mouse IgG2a AA 1-159 Log in to see
1 ABIN2306432 IF ELISA WB Mouse IgG2a kappa AA 1-158 Log in to see 4F11


Antigen MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
Reactivity Human
(70), (25), (7), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(72), (15)
Conjugate This MKNK2 antibody is un-conjugated
(7), (7), (7), (7), (7), (7)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(85), (59), (7), (7), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-MKNK2 Antibody

Target Details MKNK2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ
Isotype IgG

Target Details MKNK2

Product Details anti-MKNK2 Antibody Application Details Handling Images back to top
Alternative Name MNK2 (MKNK2 Antibody Abstract)
Background Gene Symbol: MKNK2
Gene ID 2872
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-MKNK2 Antibody Target Details MKNK2 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) antibody (ABIN5078148) Immunocytochemistry/Immunofluorescence: MNK2 Antibody - Staining of human cell line ...