You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PAK1 antibody for Immunofluorescence

Recommended PAK1 Antibody (supplied by: Log in to see )

Antigen
P21-Activated Kinase 1 (PAK1) Antibodies
  • X-PAK1
  • XPak1
  • pak
  • pak-1
  • pakalpha
  • PAKalpha
  • AW045634
  • PAK-1
  • Paka
  • p21 protein (Cdc42/Rac)-activated kinase 1
  • Protein PAK-1
  • pak1
  • PAK1
  • Pak1
  • pak-1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
335
193
184
9
9
7
5
4
4
3
2
1
1
Host
Rabbit
300
17
17
1
Clonality
Polyclonal
Conjugate
This PAK1 antibody is un-conjugated
11
11
11
7
7
7
4
4
4
4
4
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
238
127
121
61
54
52
23
22
11
7
6
5
4
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343458
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.237935 ABIN562102 IF IHC (p) IP ELISA WB Mouse IgG1 kappa AA 191-280, partial Log in to see 4D1 1
12.237935 ABIN2855705 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
12.237935 ABIN1532383 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
12.237935 ABIN2706762 IC IF IHC WB Rabbit pSer212 Log in to see Polyclonal
12.237935 ABIN2706763 IC IF IHC WB Rabbit Center Log in to see Polyclonal
12.237935 ABIN2957713 IC IF IHC WB Rabbit Log in to see Polyclonal
12.237935 ABIN2737318 IF IHC WB Rabbit IgG pThr212 Log in to see Polyclonal
12.237935 ABIN4343459 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
12.237935 ABIN2498719 IF IHC ELISA WB Rabbit IgG Ser199 Log in to see Polyclonal
12.237935 ABIN2498718 IF IHC ELISA WB Rabbit IgG Thr212 Log in to see Polyclonal
12.237935 ABIN3032114 IF IHC ELISA WB Rabbit Ig Fraction AA 401-430 Log in to see Polyclonal
12.237935 ABIN2424905 IF IHC WB Rabbit IgG pThr212 Log in to see Polyclonal
1 ABIN389799 DB IF Rabbit Ig pThr423 Log in to see Polyclonal 1
1 ABIN392432 IF IHC (p) WB Rabbit Ig AA 401-430, Thr423 Log in to see Polyclonal 1
1 ABIN196896 IF IHC (p) Rabbit pThr402, pThr421, pThr423 Log in to see Polyclonal 4
1 ABIN196878 IF IHC (p) WB Rabbit pThr212 Log in to see Polyclonal 3
1 ABIN197364 IF IHC (p) WB Rabbit Thr212 Log in to see Polyclonal 3
1 ABIN197378 IF IHC (p) Rabbit Thr423 Log in to see Polyclonal 4
1 ABIN362773 IF IHC WB Rabbit IgG AA 210-214 Log in to see Polyclonal 4
1 ABIN362156 IF IHC WB Rabbit IgG pThr212 Log in to see Polyclonal 3

Top referenced anti-PAK1 antibody for Immunofluorescence

Similar anti-PAK1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 44 Antibodies 45 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies
Immunochromatography (IC) 3 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 10 Antibodies 10 Antibodies
Immunofluorescence (IF) 39 Antibodies 39 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies 5 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 52 Antibodies 52 Antibodies
Immunohistochemistry (IHC) 74 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 44 Antibodies
Immunoprecipitation (IP) 7 Antibodies
Western Blotting (WB) 123 Antibodies

General

Antigen P21-Activated Kinase 1 (PAK1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(335), (193), (184), (9), (9), (7), (5), (4), (4), (3), (2), (1), (1)
Host Rabbit
(300), (17), (17), (1)
Clonality
Polyclonal
Conjugate This PAK1 antibody is un-conjugated
(11), (11), (11), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(238), (127), (121), (61), (54), (52), (23), (22), (11), (7), (6), (5), (4), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PAK1 Antibody

Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
Isotype IgG

Target Details PAK1

Product Details anti-PAK1 Antibody Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Antigen
Alternative Name PAK1 (PAK1 Antibody Abstract)
Background Gene Symbol: PAK1
Gene ID 5058
Research Area Kinases/Phosphatases, Apoptosis/Necrosis, Cancer
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling

Application Details

Product Details anti-PAK1 Antibody Target Details PAK1 Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PAK1 Antibody (ABIN4343458)

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling Images back to top
Product cited in:

Geiger, Velic, Macek, Lundberg, Kampf, Nagaraj, Uhlen, Cox, Mann: "Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse." in: Molecular & cellular proteomics : MCP, Vol. 12, Issue 6, pp. 1709-22, 2013

Images

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) back to top
Supplier Images
Immunofluorescence (IF) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunocytochemistry/Immunofluorescence: PAK1 Antibody [NBP1-85802] - Staining of huma...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32,...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunohistochemistry-Paraffin: PAK1 Antibody [NBP1-85802] - Staining of human cerebra...