You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human RPS6KA2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended RPS6KA2 Antibody (supplied by: Log in to see )

Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) Antibodies
  • 90kDa
  • D17Wsu134e
  • HU-2
  • p90-RSK3
  • p90rsk
  • pp90rsk
  • pp90RSK3
  • Rps6ka-rs1
  • RSK
  • RSK3
  • Rsk3
  • S6K-alpha
  • S6K-alpha2
This RPS6KA2 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4351286
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.20781031 ABIN4351287 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN562719 IF IHC (p) PLA RNAi ELISA WB Mouse IgG2a kappa AA 631-733, partial Log in to see 1F6 1
0.00089362357 ABIN2889606 IHC (p) ELISA Rabbit IgG AA 241-290 Log in to see Polyclonal
0.00089362357 ABIN790586 IF IHC (p) ELISA WB Mouse IgG2a, kappa Log in to see 1F6
0.00089362357 ABIN745253 IF (p) IHC (p) WB Rabbit IgG pThr356, pSer360 Log in to see Polyclonal
0.00089362357 ABIN700707 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN700714 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN745238 IF (p) IHC (p) WB Rabbit IgG pThr353, pThr356 Log in to see Polyclonal
0.00089362357 ABIN700705 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN2579658 IF IHC (p) ELISA Mouse IgG2a AA 631-733 Log in to see
0.00089362357 ABIN2682552 IF IHC (p) Rabbit Log in to see Polyclonal

Top referenced anti-RPS6KA2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-RPS6KA2 Antibodies

Application / Reactivity Human
ELISA 47 Antibodies
Flow Cytometry (FACS) 20 Antibodies
Immunocytochemistry (ICC) 10 Antibodies
Immunofluorescence (IF) 9 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 18 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies
RNA Interference (RNAi) 1 Antibodies
Western Blotting (WB) 60 Antibodies


Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) Antibodies
Reactivity Human
(82), (71), (32), (2), (1), (1), (1)
Host Rabbit
(65), (34), (9)
Conjugate This RPS6KA2 antibody is un-conjugated
(6), (6), (6), (5), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(84), (69), (20), (17), (13), (10), (9), (7), (2), (2), (1)
Supplier Log in to see

Product Details anti-RPS6KA2 Antibody

Target Details RPS6KA2 Application Details Handling Images
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
Isotype IgG

Target Details RPS6KA2

Product Details anti-RPS6KA2 Antibody Application Details Handling Images back to top
Alternative Name RSK3 (RPS6KA2 Antibody Abstract)
Background Gene Symbol: RPS6KA2
Research Area Signaling, DNA/RNA
Pathways MAPK Signaling, Neurotrophin Signaling Pathway

Application Details

Product Details anti-RPS6KA2 Antibody Target Details RPS6KA2 Handling Images back to top
Application Notes Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-RPS6KA2 Antibody Target Details RPS6KA2 Application Details Images back to top
Format Liquid
Buffer 40 % glycerol and PBS ( pH 7.2).
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-RPS6KA2 Antibody Target Details RPS6KA2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-RPS6KA2 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2) (ABIN4351286) Immunocytochemistry/Immunofluorescence: RSK3 Antibody [NBP2-48825] - Analysis of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RPS6KA2 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2) (ABIN4351286) Immunohistochemistry-Paraffin: RSK3 Antibody [NBP2-48825] - Staining of human prostat...