anti-Rat (Rattus) RPS6KA3 antibody for Immunohistochemistry

Recommended RPS6KA3 Antibody (supplied by: Log in to see )

Antigen
Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3 (RPS6KA3) Antibodies
  • MPK-9
  • Rsk2
  • S6K-alpha3
  • pp90RSK2
  • CLS
  • HU-3
  • ISPK-1
  • MAPKAPK1B
  • MRX19
  • RSK
  • RSK2
  • p90-RSK2
  • ribosomal protein S6 kinase polypeptide 3
  • ribosomal protein S6 kinase, 90kDa, polypeptide 3
  • Rps6ka3
  • RPS6KA3
Reactivity
Human, Mouse (Murine), Rat (Rattus)
144
70
43
9
8
7
6
4
3
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
123
29
Clonality
Polyclonal
Conjugate
This RPS6KA3 antibody is un-conjugated
6
6
6
5
4
4
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
100
44
28
25
22
21
17
13
8
5
3
3
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4351281
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1876624 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2882835 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2887395 IHC WB Rabbit Log in to see Polyclonal
1 ABIN2467744 IP IHC WB Rabbit AA 604-617 Log in to see Polyclonal
1 ABIN4351279 IHC IP WB Rabbit Log in to see Polyclonal
1 ABIN2975708 IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2354188 IHC WB Rabbit C-Term Log in to see Polyclonal

Similar anti-RPS6KA3 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
Immunocytochemistry (ICC) 1 Antibodies 2 Antibodies
Immunofluorescence (IF) 3 Antibodies 5 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 15 Antibodies 28 Antibodies
Immunohistochemistry (IHC) 8 Antibodies 11 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies 19 Antibodies
Immunoprecipitation (IP) 4 Antibodies 8 Antibodies
Western Blotting (WB) 32 Antibodies 41 Antibodies
Flow Cytometry (FACS) 14 Antibodies

General

Antigen Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3 (RPS6KA3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(144), (70), (43), (9), (8), (7), (6), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(123), (29)
Clonality
Polyclonal
Conjugate This RPS6KA3 antibody is un-conjugated
(6), (6), (6), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(100), (44), (28), (25), (22), (21), (17), (13), (8), (5), (3), (3), (2), (2)
Supplier Log in to see

Product Details anti-RPS6KA3 Antibody

Target Details RPS6KA3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
Isotype IgG

Target Details RPS6KA3

Product Details anti-RPS6KA3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name RSK2 (RPS6KA3 Antibody Abstract)
Background Gene Symbol: RPS6KA3
Gene ID 6197
Research Area Signaling
Pathways MAPK Signaling, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades

Application Details

Product Details anti-RPS6KA3 Antibody Target Details RPS6KA3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. For IF Fixation/Permeabilization: PFA/Triton X-100 is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RPS6KA3 Antibody Target Details RPS6KA3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RPS6KA3 Antibody Target Details RPS6KA3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-RPS6KA3 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3) (ABIN4351281) Western Blot: RSK2 Antibody [NBP1-85552] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32,...
Immunofluorescence (IF) image for anti-RPS6KA3 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3) (ABIN4351281) Immunocytochemistry/Immunofluorescence: RSK2 Antibody [NBP1-85552] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RPS6KA3 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3) (ABIN4351281) Immunohistochemistry-Paraffin: RSK2 Antibody [NBP1-85552] - Staining of human colon s...
Western Blotting (WB) image for anti-RPS6KA3 antibody (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 3) (ABIN4351281) Western Blot: RSK2 Antibody [NBP1-85552] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...