You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human SPZ1 antibody for Immunocytochemistry

Recommended SPZ1 Antibody (supplied by: Log in to see )

Antigen
Spermatogenic Leucine Zipper 1 (SPZ1) Antibodies
  • 1700027M20Rik
  • AI429130
  • NYD-TSP1
  • SPZ1
Reactivity
Human
16
11
3
2
Host
Rabbit
21
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
16
10
9
5
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355782
Contact our Customer Service for availability and price in your country.

Similar anti-SPZ1 Antibodies

Application / Reactivity Human
ELISA 9 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 6 Antibodies
Immunohistochemistry (IHC) 10 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies
Western Blotting (WB) 11 Antibodies

General

Antigen Spermatogenic Leucine Zipper 1 (SPZ1) Antibodies
Reactivity Human
(16), (11), (3), (2)
Host Rabbit
(21), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(16), (10), (9), (5), (3), (1)
Supplier Log in to see

Product Details anti-SPZ1 Antibody

Target Details SPZ1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQEMILETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQ
Isotype IgG

Target Details SPZ1

Product Details anti-SPZ1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SPZ1 (SPZ1 Antibody Abstract)
Background Gene Symbol: SPZ1
Research Area Transcription Factors, Chromatin and Nuclear Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-SPZ1 Antibody Target Details SPZ1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SPZ1 Antibody Target Details SPZ1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SPZ1 Antibody Target Details SPZ1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-SPZ1 antibody (Spermatogenic Leucine Zipper 1) (ABIN4355782) Immunocytochemistry/Immunofluorescence: SPZ1 Antibody [NBP1-82053] - Staining of huma...
Western Blotting (WB) image for anti-SPZ1 antibody (Spermatogenic Leucine Zipper 1) (ABIN4355782) Western Blot: SPZ1 Antibody [NBP1-82053] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SPZ1 antibody (Spermatogenic Leucine Zipper 1) (ABIN4355782) Immunohistochemistry-Paraffin: SPZ1 Antibody [NBP1-82053] - Immunohistochemical stain...