anti-Human CLIP2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CLIP2 Antibody (supplied by: Log in to see )

Antigen
CAP-GLY Domain Containing Linker Protein 2 (CLIP2) Antibodies
  • CYLN2
  • CLIP
  • CLIP-115
  • WBSCR3
  • WBSCR4
  • WSCR3
  • WSCR4
  • Cyln2
  • B230327O20
  • Clip1
  • mKIAA0291
  • wbscr4
  • CAP-GLY domain containing linker protein 2
  • CLIP2
  • clip2
  • Clip2
Reactivity
Human
51
30
20
4
1
Host
Rabbit
45
6
Clonality
Polyclonal
Conjugate
This CLIP2 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
36
23
13
4
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4301707
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1408430 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1390537 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN1386507 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

General

Antigen CAP-GLY Domain Containing Linker Protein 2 (CLIP2) Antibodies
Reactivity Human
(51), (30), (20), (4), (1)
Host Rabbit
(45), (6)
Clonality
Polyclonal
Conjugate This CLIP2 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(36), (23), (13), (4), (3), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-CLIP2 Antibody

Target Details CLIP2 Application Details Handling ProductDetails: References for anti-CLIP2 antibody (ABIN4301707) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
Isotype IgG

Target Details CLIP2

Product Details anti-CLIP2 Antibody Application Details Handling ProductDetails: References for anti-CLIP2 antibody (ABIN4301707) Images back to top
Antigen
Alternative Name CYLN2 (CLIP2 Antibody Abstract)
Background Gene Symbol: CLIP2
Gene ID 7461
Research Area Neurology
Pathways Microtubule Dynamics

Application Details

Product Details anti-CLIP2 Antibody Target Details CLIP2 Handling ProductDetails: References for anti-CLIP2 antibody (ABIN4301707) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CLIP2 Antibody Target Details CLIP2 Application Details ProductDetails: References for anti-CLIP2 antibody (ABIN4301707) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-CLIP2 antibody (ABIN4301707)

Product Details anti-CLIP2 Antibody Target Details CLIP2 Application Details Handling Images back to top
Product cited in:

Selmansberger, Feuchtinger, Zurnadzhy, Michna, Kaiser, Abend, Brenner, Bogdanova, Walch, Unger, Zitzelsberger, Hess: "CLIP2 as radiation biomarker in papillary thyroid carcinoma." in: Oncogene, Vol. 34, Issue 30, pp. 3917-25, 2015 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-CLIP2 Antibody Target Details CLIP2 Application Details Handling ProductDetails: References for anti-CLIP2 antibody (ABIN4301707) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Immunohistochemistry: CYLN2 Antibody [NBP1-85569] - Staining of human rectum shows st...
Western Blotting (WB) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Western Blot: CYLN2 Antibody [NBP1-85569] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Immunohistochemistry-Paraffin: CYLN2 Antibody - Staining of human rectum shows stron...