You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAP1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP1B Antibody (supplied by: Log in to see )

Antigen
Microtubule-Associated Protein 1B (MAP1B) Antibodies
  • A230055D22
  • AI843217
  • FUTSCH
  • LC1
  • MAP5
  • Mtap-5
  • Mtap1b
  • Mtap5
Reactivity
Human
57
49
45
19
18
17
12
12
1
Host
Rabbit
48
20
Clonality
Polyclonal
Conjugate
This MAP1B antibody is un-conjugated
5
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
34
30
25
20
15
12
11
6
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332596
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.000899519 ABIN180320 IHC (fro) IF IHC (p) IP WB Mouse IgG1 Log in to see 3G5
0.000899519 ABIN187618 IF IHC (p) Mouse IgG1 Log in to see 3G5
0.000899519 ABIN1723289 IF IHC (p) Mouse IgG1 Log in to see 3G5
0.000899519 ABIN1724344 IF IHC (p) IHC Mouse IgG1 Log in to see
0.000899519 ABIN1406738 IHC (p) HRP Rabbit IgG AA 490-540 Log in to see Polyclonal
0.000899519 ABIN448131 IF IHC (p) Mouse IgG1 Log in to see 3G5
0.000899519 ABIN1388845 IHC (p) Biotin Rabbit IgG AA 490-540 Log in to see Polyclonal
0.000899519 ABIN1385602 IF (p) IHC (p) Rabbit IgG AA 490-540 Log in to see Polyclonal

Top referenced anti-MAP1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-MAP1B Antibodies

Application / Reactivity Human
ELISA 6 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunocytochemistry (ICC) 12 Antibodies
Immunofluorescence (IF) 23 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies
Immunohistochemistry (IHC) 20 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 20 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Microarray (MA) 1 Antibodies
Western Blotting (WB) 33 Antibodies

General

Antigen Microtubule-Associated Protein 1B (MAP1B) Antibodies
Reactivity Human
(57), (49), (45), (19), (18), (17), (12), (12), (1)
Host Rabbit
(48), (20)
Clonality
Polyclonal
Conjugate This MAP1B antibody is un-conjugated
(5), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(34), (30), (25), (20), (15), (12), (11), (6), (4), (2), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-MAP1B Antibody

Target Details MAP1B Application Details Handling References for anti-MAP1B Antibody (ABIN4332596) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
Isotype IgG

Target Details MAP1B

Product Details anti-MAP1B Antibody Application Details Handling References for anti-MAP1B Antibody (ABIN4332596) Images back to top
Antigen
Alternative Name MAP1B (MAP1B Antibody Abstract)
Background Gene Symbol: MAP1B
Pathways Microtubule Dynamics

Application Details

Product Details anti-MAP1B Antibody Target Details MAP1B Handling References for anti-MAP1B Antibody (ABIN4332596) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details References for anti-MAP1B Antibody (ABIN4332596) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MAP1B Antibody (ABIN4332596)

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details Handling Images back to top
Product cited in:

Isella, Terrasi, Bellomo, Petti, Galatola, Muratore, Mellano, Senetta, Cassenti, Sonetto, Inghirami, Trusolino, Fekete, De Ridder, Cassoni, Storme, Bertotti, Medico: "Stromal contribution to the colorectal cancer transcriptome." in: Nature genetics, Vol. 47, Issue 4, pp. 312-9, 2015 (Sample species: Human). Further details: Immunohistochemistry

Danielsson, Wiking, Mahdessian, Skogs, Ait Blal, Hjelmare, Stadler, Uhlén, Lundberg: "RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins." in: Journal of proteome research, Vol. 12, Issue 1, pp. 299-307, 2013

Images

Product Details anti-MAP1B Antibody Target Details MAP1B Application Details Handling References for anti-MAP1B Antibody (ABIN4332596) back to top
Supplier Images
Immunofluorescence (IF) image for anti-MAP1B antibody (Microtubule-Associated Protein 1B) (ABIN4332596) Immunocytochemistry/Immunofluorescence: MAP1B Antibody [NBP1-81261] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAP1B antibody (Microtubule-Associated Protein 1B) (ABIN4332596) Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebr...