anti-Mouse (Murine) ROCK2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended ROCK2 Antibody (supplied by: Log in to see )

Antigen
rho-Associated, Coiled-Coil Containing Protein Kinase 2 (ROCK2) Antibodies
  • rocka-a
  • xROK
  • rock2
  • rok2
  • ROCK2
  • B230113H15Rik
  • ROKalpha
  • Rho-kinase
  • Rock-II
  • Rock2m
  • mKIAA0619
  • ROCK-II
  • ROK
  • Rho-associated, coiled-coil containing protein kinase 2
  • rho-associated, coiled-coil containing protein kinase 2a
  • Rho-associated coiled-coil containing protein kinase 2
  • Rho-associated coiled-coil containing protein kinase 2-like
  • rock2
  • rock2a
  • ROCK2
  • Rock2
  • LOC100346837
Reactivity
Human, Mouse (Murine), Rat (Rattus)
170
117
112
9
5
5
3
3
2
2
1
1
1
1
1
1
Host
Rabbit
149
21
1
Clonality
Polyclonal
Conjugate
This ROCK2 antibody is un-conjugated
5
5
4
3
3
3
3
3
3
3
3
3
3
3
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
126
45
40
37
34
28
25
11
3
3
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4350923
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.403178 ABIN615037 IHC (p) WB Rabbit IgG Log in to see Polyclonal
13.403178 ABIN4350924 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
13.403178 ABIN364441 IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN673359 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 2
1 ABIN1108892 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 2
1 ABIN3043921 IHC (p) WB Rabbit IgG AA 652-923 Log in to see Polyclonal
1 ABIN3187730 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2855440 ICC IF IP IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN959684 IHC (p) WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN1495063 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN958934 IHC (p) Rabbit AA 511-560 Log in to see Polyclonal
1 ABIN713075 IHC (p) WB HRP Rabbit IgG pThr396 Log in to see Polyclonal
1 ABIN673368 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN713090 IHC (p) WB HRP Rabbit IgG pThr249 Log in to see Polyclonal
1 ABIN4350922 ELISA IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN600178 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN673361 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN713083 IHC (p) WB Biotin Rabbit IgG pThr249 Log in to see Polyclonal
1 ABIN713068 IHC (p) WB Biotin Rabbit IgG pThr396 Log in to see Polyclonal
1 ABIN713096 IF (p) IHC (p) WB Rabbit IgG pTyr256 Log in to see Polyclonal

Top referenced anti-ROCK2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-ROCK2 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 22 Antibodies 22 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies 3 Antibodies
Immunofluorescence (IF) 10 Antibodies 10 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 40 Antibodies 40 Antibodies
Immunohistochemistry (IHC) 20 Antibodies 20 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 27 Antibodies 27 Antibodies
Immunoprecipitation (IP) 16 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 68 Antibodies

General

Antigen rho-Associated, Coiled-Coil Containing Protein Kinase 2 (ROCK2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(170), (117), (112), (9), (5), (5), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(149), (21), (1)
Clonality
Polyclonal
Conjugate This ROCK2 antibody is un-conjugated
(5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(126), (45), (40), (37), (34), (28), (25), (11), (3), (3), (2)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-ROCK2 Antibody

Target Details ROCK2 Application Details Handling ProductDetails: References for anti-ROCK2 antibody (ABIN4350923) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK
Isotype IgG

Target Details ROCK2

Product Details anti-ROCK2 Antibody Application Details Handling ProductDetails: References for anti-ROCK2 antibody (ABIN4350923) Images back to top
Antigen
Alternative Name ROCK2 (ROCK2 Antibody Abstract)
Background Gene Symbol: ROCK2
Gene ID 9475
Research Area Apoptosis/Necrosis, Cancer
Pathways Microtubule Dynamics, WNT Signaling, Tube Formation

Application Details

Product Details anti-ROCK2 Antibody Target Details ROCK2 Handling ProductDetails: References for anti-ROCK2 antibody (ABIN4350923) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ROCK2 Antibody Target Details ROCK2 Application Details ProductDetails: References for anti-ROCK2 antibody (ABIN4350923) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-ROCK2 antibody (ABIN4350923)

Product Details anti-ROCK2 Antibody Target Details ROCK2 Application Details Handling Images back to top
Product cited in:

Mikami, Yoshida, Sawada, Esaki, Yasumura, Ono: "Inhibition of Rho-associated kinases disturbs the collective cell migration of stratified TE-10 cells." in: Biological research, Vol. 48, pp. 48, 2015 (Sample species: Human). Further details: Western Blotting

Bozóky, Savchenko, Csermely, Korcsmáros, Dúl, Pontén, Székely, Klein: "Novel signatures of cancer-associated fibroblasts." in: International journal of cancer, Vol. 133, Issue 2, pp. 286-93, 2013

Images

Product Details anti-ROCK2 Antibody Target Details ROCK2 Application Details Handling ProductDetails: References for anti-ROCK2 antibody (ABIN4350923) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ROCK2 antibody (rho-Associated, Coiled-Coil Containing Protein Kinase 2) (ABIN4350923) Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Immunohistochemical stai...
Immunofluorescence (IF) image for anti-ROCK2 antibody (rho-Associated, Coiled-Coil Containing Protein Kinase 2) (ABIN4350923) Immunocytochemistry/Immunofluorescence: ROCK2 Antibody [NBP1-86124] - Immunofluoresce...
Western Blotting (WB) image for anti-ROCK2 antibody (rho-Associated, Coiled-Coil Containing Protein Kinase 2) (ABIN4350923) Western Blot: ROCK2 Antibody [NBP1-86124] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Western Blotting (WB) image for anti-ROCK2 antibody (rho-Associated, Coiled-Coil Containing Protein Kinase 2) (ABIN4350923) Western Blot: ROCK2 Antibody [NBP1-86124] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...