You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) Spastin antibody for Western Blotting

Recommended Spastin Antibody (supplied by: Log in to see )

Antigen
Spastin (SPAST) Antibodies
  • ADPSP
  • CG5977
  • D-spastin
  • Dmel\\CG5977
  • Dspastin
  • FSP2
  • LOC100224472
  • mKIAA1083
  • Spas
  • SPAST
  • Spg4
  • SPG4
  • spg4
  • zgc:85952
Reactivity
Human, Rat (Rattus)
59
42
42
1
Host
Rabbit
45
14
Clonality
Polyclonal
Conjugate
This Spastin antibody is un-conjugated
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
54
52
5
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355519
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0012208585 ABIN4245054 ELISA IF WB Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4355520 ChIP ELISA IF IHC WB Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN572141 IHC WB Rabbit C-Term Log in to see Polyclonal
0.0012208585 ABIN4245083 ELISA WB DyLight 488 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245090 ELISA WB DyLight 405LS Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245063 ELISA WB FITC Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245064 ELISA WB DyLight 680 Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245057 ELISA WB Alexa Fluor 405 Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245070 ELISA WB DyLight 550 Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245073 ELISA WB DyLight 405LS Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245075 ELISA WB Alexa Fluor 488 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245077 ELISA WB Alexa Fluor 700 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245082 ELISA WB DyLight 680 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245078 ELISA WB Allophycocyanin Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245080 ELISA WB DyLight 650 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245085 ELISA WB DyLight 755 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245056 ELISA WB DyLight 405 Mouse IgG2a Log in to see Sp 6C6
0.0012208585 ABIN4245058 ELISA WB Alexa Fluor 647 Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245060 ELISA WB Allophycocyanin Mouse IgG2a Log in to see Sp 3G11-1
0.0012208585 ABIN4245059 ELISA WB Alexa Fluor 700 Mouse IgG2a Log in to see Sp 3G11-1

Similar anti-Spastin Antibodies

Application / Reactivity Rat (Rattus) Human
Chromatin Immunoprecipitation (ChIP) 1 Antibodies 1 Antibodies
ELISA 40 Antibodies 53 Antibodies
Immunofluorescence (IF) 2 Antibodies 4 Antibodies
Immunohistochemistry (IHC) 5 Antibodies 6 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 3 Antibodies
Western Blotting (WB) 41 Antibodies 56 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies

General

Antigen Spastin (SPAST) Antibodies
Reactivity Human, Rat (Rattus)
(59), (42), (42), (1)
Host Rabbit
(45), (14)
Clonality
Polyclonal
Conjugate This Spastin antibody is un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(54), (52), (5), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-Spastin Antibody

Target Details Spastin Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGL
Isotype IgG

Target Details Spastin

Product Details anti-Spastin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Spastin (SPAST Antibody Abstract)
Background Gene Symbol: SPAST
Research Area Signaling, Cytoskeleton, Metabolism
Pathways Microtubule Dynamics

Application Details

Product Details anti-Spastin Antibody Target Details Spastin Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Spastin Antibody Target Details Spastin Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Spastin Antibody Target Details Spastin Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Spastin antibody (SPAST) (ABIN4355519) Immunohistochemistry-Paraffin: Spastin Antibody [NBP1-90230] - Immunohistochemical st...
Western Blotting (WB) image for anti-Spastin antibody (SPAST) (ABIN4355519) Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Western Blotting (WB) image for anti-Spastin antibody (SPAST) (ABIN4355519) Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: NIH-3T3 cell lysate (Mouse embr...