anti-Human Growth Hormone Receptor antibody for Immunofluorescence

Recommended Growth Hormone Receptor Antibody (supplied by: Log in to see )

Antigen
Growth Hormone Receptor (GHR) Antibodies
  • GHBP
  • AA986417
  • GHR/BP
  • GHR
  • ghr
  • growth hormone receptor
  • growth hormone receptor L homeolog
  • GHR
  • Ghr
  • ghr.L
  • ghr
Reactivity
Human
67
39
37
17
2
2
1
1
1
1
Host
Rabbit
69
16
2
Clonality
Polyclonal
Conjugate
This Growth Hormone Receptor antibody is un-conjugated
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
54
30
14
13
13
11
4
3
3
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077058
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5077057 ICC IF IHC (p) Rabbit IgG Log in to see Polyclonal

General

Antigen Growth Hormone Receptor (GHR) Antibodies
Reactivity Human
(67), (39), (37), (17), (2), (2), (1), (1), (1), (1)
Host Rabbit
(69), (16), (2)
Clonality
Polyclonal
Conjugate This Growth Hormone Receptor antibody is un-conjugated
(3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(54), (30), (14), (13), (13), (11), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Growth Hormone Receptor Antibody

Target Details Growth Hormone Receptor Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPP
Isotype IgG

Target Details Growth Hormone Receptor

Product Details anti-Growth Hormone Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name Growth Hormone R (GHR Antibody Abstract)
Background Gene Symbol: GHR
Gene ID 2690
Pathways NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus

Application Details

Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Growth Hormone Receptor Antibody Target Details Growth Hormone Receptor Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Growth Hormone Receptor (GHR) antibody (ABIN5077058) Immunocytochemistry/Immunofluorescence: Growth Hormone R Antibody - Staining of huma...