You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) IKBKG antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IKBKG Antibody (supplied by: Log in to see )

Antigen
Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma (IKBKG) Antibodies
  • 1110037D23Rik
  • AI848108
  • AI851264
  • AMCBX1
  • AW124339
  • CG16910
  • dIKK
  • dIKK-gamma
  • Dmel\\CG16910
  • DmIKK-gamma
  • dmIKKgamma
  • Dmikkgamma
  • DmIKKgamma
  • FIP-3
  • FIP3
  • Fip3p
  • fj33c07
  • IKBKG
  • IKBKG_1
  • IKBKG_2
  • IKK
  • IKK-gamma
  • IKKg
  • IKKgamma
  • IKK[g]
  • IKK[[gamma]]
  • IP
  • IP1
  • IP2
  • IPD2
  • Kenny
  • Key
  • KEY
  • MGC97885
  • nemo
  • Nemo
  • NEMO
  • wu:fj33c07
  • ZC2HC9
  • zgc:113492
Reactivity
Human, Mouse (Murine), Rat (Rattus)
301
96
65
5
4
4
3
2
2
2
2
2
1
1
Host
Rabbit
215
93
2
2
1
Clonality
Polyclonal
Conjugate
This IKBKG antibody is un-conjugated
10
9
7
6
6
5
4
4
4
4
4
4
4
3
3
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
238
106
73
45
43
37
24
23
5
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324314
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089362357 ABIN567775 IHC (p) IP WB Mouse IgG1 AA 262-319 Log in to see EA2-6 2
0.00089362357 ABIN302821 IF IHC (p) WB Rabbit AA 400-416 Log in to see Polyclonal
0.00089362357 ABIN681373 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN801408 IF (p) IHC (p) WB Rabbit IgG pSer43 Log in to see Polyclonal
0.00089362357 ABIN1735861 ICC IHC (p) WB Rabbit IgG AA 400-416 Log in to see Polyclonal
0.00089362357 ABIN681375 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN681382 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.00089362357 ABIN801410 IHC (p) WB Biotin Rabbit IgG pSer43 Log in to see Polyclonal
0.00089362357 ABIN801417 IHC (p) WB HRP Rabbit IgG pSer43 Log in to see Polyclonal
0.00089362357 ABIN4324313 ELISA ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal 1
0.00089362357 ABIN4901765 ELISA IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-IKBKG antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-IKBKG Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 14 Antibodies 21 Antibodies
Immunochromatography (IC) 2 Antibodies 2 Antibodies
Immunocytochemistry (ICC) 11 Antibodies 12 Antibodies
Immunofluorescence (IF) 9 Antibodies 12 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 22 Antibodies 22 Antibodies
Immunohistochemistry (IHC) 15 Antibodies 18 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies 13 Antibodies
Immunoprecipitation (IP) 3 Antibodies 5 Antibodies
Western Blotting (WB) 40 Antibodies
Simple Western (SimWes) 2 Antibodies

General

Antigen Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma (IKBKG) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(301), (96), (65), (5), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(215), (93), (2), (2), (1)
Clonality
Polyclonal
Conjugate This IKBKG antibody is un-conjugated
(10), (9), (7), (6), (6), (5), (4), (4), (4), (4), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(238), (106), (73), (45), (43), (37), (24), (23), (5), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-IKBKG Antibody

Target Details IKBKG Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL
Isotype IgG

Target Details IKBKG

Product Details anti-IKBKG Antibody Application Details Handling Images back to top
Antigen
Alternative Name IKK gamma (IKBKG Antibody Abstract)
Background Gene Symbol: IKBKG
Research Area Immunology, Innate Immunity, Atherosclerosis, Transcription Factors, Apoptosis/Necrosis
Pathways NF-kappaB Signaling, RTK Signaling, TCR Signaling, TLR Signaling, Fc-epsilon Receptor Signaling Pathway

Application Details

Product Details anti-IKBKG Antibody Target Details IKBKG Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IKBKG Antibody Target Details IKBKG Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IKBKG Antibody Target Details IKBKG Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IKBKG antibody (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma) (ABIN4324314) Immunohistochemistry: IKK gamma Antibody [NBP1-84681] - Lane 1: NIH-3T3 cell lysate (...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IKBKG antibody (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma) (ABIN4324314) Immunohistochemistry-Paraffin: IKK gamma Antibody [NBP1-84681] - Staining of human pl...
Western Blotting (WB) image for anti-IKBKG antibody (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma) (ABIN4324314) Western Blot: IKK gamma Antibody [NBP1-84681] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Immunofluorescence (IF) image for anti-IKBKG antibody (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma) (ABIN4324314) Immunocytochemistry/Immunofluorescence: IKK gamma Antibody [NBP1-84681] - Staining of...
Western Blotting (WB) image for anti-IKBKG antibody (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase gamma) (ABIN4324314) Western Blot: IKK gamma Antibody [NBP1-84681] - Lane 1: Marker [kDa] 230, 130, 95, 72...