anti-Human Insulin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Insulin Antibody (supplied by: Log in to see )

Antigen
Insulin (INS) Antibodies
  • ins1
  • xins
  • ins1-a
  • Insulin
  • IDDM2
  • ILPR
  • IRDN
  • MODY10
  • AA986540
  • Ins-2
  • InsII
  • Mody
  • Mody4
  • proinsulin
  • zgc:109842
  • insulin
  • insulin precursor
  • insulin II
  • insulin-like
  • preproinsulin
  • ins
  • PIN
  • INS
  • Ins
  • Ins2
  • LOC100060077
Reactivity
Human
933
395
284
271
263
121
49
6
6
5
5
5
4
3
2
1
1
1
1
1
1
1
Host
Rabbit
822
175
55
16
2
1
Clonality
Polyclonal
Conjugate
This Insulin antibody is un-conjugated
55
42
41
27
26
26
21
21
18
17
17
17
17
17
17
16
16
12
11
10
9
9
9
5
5
5
5
5
5
2
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
615
361
242
221
205
200
158
137
70
66
38
29
14
11
9
9
8
7
5
4
3
3
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4326017
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.850952 ABIN316680 EIA IHC (p) Mouse IgG1 Log in to see 2D11
13.850952 ABIN337134 IHC (p) ELISA HRP Mouse IgG1, kappa Log in to see 8E2
13.850952 ABIN214027 IHC (p) ELISA WB Mouse IgG1, kappa Log in to see 2D11-H5
13.850952 ABIN260218 IHC (p) IHC ELISA Mouse IgG1 Log in to see 2D11
13.850952 ABIN4347575 ELISA IHC (p) WB Mouse IgG1 Log in to see HPI-B5
13.850952 ABIN269045 ICC IF IHC (p) IHC RIA ELISA Mouse IgG1 Log in to see C-PEP-01
13.850952 ABIN269653 DB ICC IF IHC (p) IHC RIA Mouse IgG1 Log in to see K36aC10
13.850952 ABIN498557 IHC (p) Rabbit Log in to see Polyclonal
13.850952 ABIN461989 IHC (p) ELISA Mouse IgG1 Log in to see
13.850952 ABIN448377 IHC (p) IHC Mouse IgG1 Log in to see ISL-8J
13.850952 ABIN396953 IHC (p) Mouse IgG1, kappa Log in to see
13.850952 ABIN261237 ELISA IHC (p) Mouse IgG1 kappa Log in to see 8E2
13.850952 ABIN337249 FACS ICC IF IHC (p) Rabbit IgG Log in to see Polyclonal
13.850952 ABIN4326016 FACS ICC IF IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN112214 EIA IHC (fro) IHC (p) Mouse IgG1 Log in to see D3E7 (5B6-6) 1
1 ABIN111474 EIA IHC (fro) IHC (p) Mouse IgG1 Log in to see C-PEP-01 1
1 ABIN112181 IHC (p) Mouse IgG1 Log in to see E2E3 2
1 ABIN1107760 IHC (p) IP Mouse IgG1 Log in to see ISL-8J 1
1 ABIN111464 EIA IHC (fro) IHC (p) Mouse IgG1 Log in to see C-PEP-01 2
1 ABIN111475 EIA IHC (fro) IHC (p) RIA Mouse IgG1 Log in to see C-PEP-01 1

Top referenced anti-Insulin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Insulin Antibodies

Application / Reactivity Human
Blocking Reagent (BR) 2 Antibodies
Cytometry by Time of Flight (CyTOF) 14 Antibodies
Dot Blot (DB) 1 Antibodies
ELISA 494 Antibodies
ELISA (Capture) 6 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 27 Antibodies
Flow Cytometry (FACS) 200 Antibodies
Functional Studies (Func) 9 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 128 Antibodies
Immunoelectron Microscopy (IEM) 1 Antibodies
Immunofluorescence (IF) 153 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 65 Antibodies
Immunohistochemistry (IHC) 213 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 4 Antibodies

General

Antigen Insulin (INS) Antibodies
Reactivity Human
(933), (395), (284), (271), (263), (121), (49), (6), (6), (5), (5), (5), (4), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(822), (175), (55), (16), (2), (1)
Clonality
Polyclonal
Conjugate This Insulin antibody is un-conjugated
(55), (42), (41), (27), (26), (26), (21), (21), (18), (17), (17), (17), (17), (17), (17), (16), (16), (12), (11), (10), (9), (9), (9), (5), (5), (5), (5), (5), (5), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(615), (361), (242), (221), (205), (200), (158), (137), (70), (66), (38), (29), (14), (11), (9), (9), (8), (7), (5), (4), (3), (3), (2), (2), (2), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Insulin Antibody

Target Details Insulin Application Details Handling ProductDetails: References for anti-Insulin antibody (ABIN4326017) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Isotype IgG

Target Details Insulin

Product Details anti-Insulin Antibody Application Details Handling ProductDetails: References for anti-Insulin antibody (ABIN4326017) Images back to top
Antigen
Alternative Name Insulin (INS Antibody Abstract)
Background Gene Symbol: INS
Gene ID 3630
Research Area Neurology, Diabetes, Hormones
Pathways NF-kappaB Signaling, RTK Signaling, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Hormone Activity, Carbohydrate Homeostasis, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Autophagy, Negative Regulation of intrinsic apoptotic Signaling, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation

Application Details

Product Details anti-Insulin Antibody Target Details Insulin Handling ProductDetails: References for anti-Insulin antibody (ABIN4326017) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Insulin Antibody Target Details Insulin Application Details ProductDetails: References for anti-Insulin antibody (ABIN4326017) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-Insulin antibody (ABIN4326017)

Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling Images back to top
Product cited in:

Lindskog, Korsgren, Pontén, Eriksson, Johansson, Danielsson: "Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates." in: Journal of proteomics, Vol. 75, Issue 9, pp. 2611-20, 2012

Lindskog, Asplund, Engkvist, Uhlen, Korsgren, Ponten: "Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets." in: Discovery medicine, Vol. 9, Issue 49, pp. 565-78, 2010

Images

Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling ProductDetails: References for anti-Insulin antibody (ABIN4326017) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin antibody (INS) (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human panc...
Western Blotting (WB) image for anti-Insulin antibody (INS) (ABIN4326017) Western Blot: Insulin Antibody [NBP1-87485] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...