You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Insulin antibody for Western Blotting

Recommended Insulin Antibody (supplied by: Log in to see )

Insulin (INS) Antibodies
  • ins1
  • xins
  • ins1-a
  • Insulin
  • IDDM2
  • ILPR
  • IRDN
  • MODY10
  • AA986540
  • Ins-2
  • InsII
  • Mody
  • Mody4
  • proinsulin
  • zgc:109842
  • insulin
  • insulin precursor
  • insulin II
  • insulin-like
  • preproinsulin
  • ins
  • PIN
  • INS
  • Ins
  • Ins2
  • LOC100060077
This Insulin antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4326017
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
2.8468342 ABIN411521 WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN411565 IHC ELISA WB Mouse IgG1 full length Log in to see HPI-B5
2.8468342 ABIN487416 EIA IHC (fro) WB Mouse IgG1 Log in to see HPI-B5
2.8468342 ABIN2706403 WB Rabbit Center Log in to see Polyclonal
2.8468342 ABIN2706402 WB Rabbit Center Log in to see Polyclonal
2.8468342 ABIN1873240 IHC WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN1539839 WB Mouse IgM AA 35-64 Log in to see 396CT20-4-4
2.8468342 ABIN1539840 WB Mouse IgM AA 35-64 Log in to see 396CT20-4-4
2.8468342 ABIN729118 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN3023553 WB Rabbit IgG pTyr1361 Log in to see
2.8468342 ABIN3023559 WB Rabbit IgG pTyr1189 Log in to see Polyclonal
2.8468342 ABIN3020884 WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN4226797 WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN3028737 ELISA WB Mouse IgM AA 35-64 Log in to see 396CT20-4-4
2.8468342 ABIN3022885 IHC WB Rabbit IgG Log in to see Polyclonal
2.8468342 ABIN3031331 ELISA WB Mouse IgM AA 35-64 Log in to see 396CT20-4-4
2.8468342 ABIN2488139 WB Mouse IgM Log in to see 396CT20-4-4
2.8468342 ABIN2488138 WB Mouse IgM Log in to see 396CT20-4-4
2.8468342 ABIN2405054 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN117970 EIA IHC (fro) IP WB Mouse IgG1 Log in to see 2D11-H5 1

Top referenced anti-Insulin antibody for Western Blotting

Similar anti-Insulin Antibodies

Application / Reactivity Human
Cytometry by Time of Flight (CyTOF) 14 Antibodies
Dot Blot (DB) 1 Antibodies
ELISA 489 Antibodies
ELISA (Capture) 6 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 27 Antibodies
Flow Cytometry (FACS) 190 Antibodies
Functional Studies (Func) 10 Antibodies
Immunoassay (IA) 8 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 134 Antibodies
Immunoelectron Microscopy (IEM) 1 Antibodies
Immunofluorescence (IF) 154 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 55 Antibodies
Immunohistochemistry (IHC) 208 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 2 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 4 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 2 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 184 Antibodies


Antigen Insulin (INS) Antibodies
Reactivity Human
(902), (373), (251), (242), (241), (116), (49), (5), (5), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(820), (175), (57), (9), (2), (2)
Conjugate This Insulin antibody is un-conjugated
(54), (40), (40), (26), (24), (24), (19), (19), (18), (17), (17), (17), (17), (17), (17), (16), (16), (11), (11), (9), (7), (7), (5), (5), (5), (5), (5), (2), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(623), (356), (227), (211), (210), (193), (158), (145), (60), (56), (43), (28), (14), (12), (11), (9), (8), (7), (6), (5), (5), (4), (3), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Insulin Antibody

Target Details Insulin Application Details Handling References for anti-Insulin Antibody (ABIN4326017) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC
Isotype IgG

Target Details Insulin

Product Details anti-Insulin Antibody Application Details Handling References for anti-Insulin Antibody (ABIN4326017) Images back to top
Alternative Name Insulin (INS Antibody Abstract)
Background Gene Symbol: INS
Gene ID 3630
Research Area Neurology, Diabetes, Hormones
Pathways NF-kappaB Signaling, RTK Signaling

Application Details

Product Details anti-Insulin Antibody Target Details Insulin Handling References for anti-Insulin Antibody (ABIN4326017) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Insulin Antibody Target Details Insulin Application Details References for anti-Insulin Antibody (ABIN4326017) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Insulin Antibody (ABIN4326017)

Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling Images back to top
Product cited in:

Lindskog, Korsgren, Pontén, Eriksson, Johansson, Danielsson: "Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates." in: Journal of proteomics, Vol. 75, Issue 9, pp. 2611-20, 2012

Lindskog, Asplund, Engkvist, Uhlen, Korsgren, Ponten: "Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets." in: Discovery medicine, Vol. 9, Issue 49, pp. 565-78, 2010


Product Details anti-Insulin Antibody Target Details Insulin Application Details Handling References for anti-Insulin Antibody (ABIN4326017) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Insulin antibody (INS) (ABIN4326017) Immunohistochemistry-Paraffin: Insulin Antibody [NBP1-87485] - Staining of human panc...
Western Blotting (WB) image for anti-Insulin antibody (INS) (ABIN4326017) Western Blot: Insulin Antibody [NBP1-87485] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...