You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human NFKB1 antibody for Immunohistochemistry (Frozen Sections)

Recommended NFKB1 Antibody (supplied by: Log in to see )

Antigen
Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells 1 (NFKB1) Antibodies
  • BICDR-1
  • bicdr1
  • ccdc64
  • EBP-1
  • ebp-1
  • KBF1
  • kbf1
  • NF-kappa-B
  • nf-kappa-b
  • nf-kappaB
  • NF-kappaB
  • NF-kappaB1
  • NF-kB
  • NF-KB1
  • NF-kB1
  • NFkappaB
  • NFKB-p50
  • nfkb-p50
  • nfkb-p105
  • NFKB-p105
  • p50
  • p50/p105
  • p105
Epitope
AA 42-367
44
42
41
39
37
35
28
15
13
13
13
11
10
8
7
7
5
4
4
4
4
4
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
499
154
135
17
17
14
12
1
1
Host
Rabbit
471
52
4
2
Clonality
Polyclonal
Conjugate
This NFKB1 antibody is un-conjugated
18
16
13
6
6
6
6
6
6
6
6
6
5
5
5
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
397
211
170
101
85
68
42
24
14
9
9
7
4
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1078409
$ 365.20
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008852861 ABIN184428 IHC (fro) IP WB Rabbit C-Term Log in to see Polyclonal
0.0008852861 ABIN1980478 ICC IHC (fro) IHC (p) ELISA WB Rabbit AA 805-892 Log in to see Polyclonal

Similar anti-NFKB1 Antibodies

Application / Reactivity Human
Dot Blot (DB) 9 Antibodies
Electrophoretic Mobility-Shift Assay (EMSA) 1 Antibodies
ELISA 164 Antibodies
Enzyme Immunoassay (EIA) 9 Antibodies
Flow Cytometry (FACS) 15 Antibodies
Gel Shift (GS) 7 Antibodies
Immunochromatography (IC) 4 Antibodies
Immunocytochemistry (ICC) 26 Antibodies
Immunofluorescence (IF) 103 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 57 Antibodies
Immunohistochemistry (IHC) 210 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 83 Antibodies
Immunoprecipitation (IP) 42 Antibodies
Intracellular Staining (ICS) 1 Antibodies
Proximity Ligation Assay (PLA) 4 Antibodies

General

Antigen Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells 1 (NFKB1) Antibodies
Epitope AA 42-367
(44), (42), (41), (39), (37), (35), (28), (15), (13), (13), (13), (11), (10), (8), (7), (7), (5), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(499), (154), (135), (17), (17), (14), (12), (1), (1)
Host Rabbit
(471), (52), (4), (2)
Clonality
Polyclonal
Conjugate This NFKB1 antibody is un-conjugated
(18), (16), (13), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (5), (5)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(397), (211), (170), (101), (85), (68), (42), (24), (14), (9), (9), (7), (4), (4), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-NFKB1 Antibody

Target Details NFKB1 Application Details Handling Images
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-PYLQILEQP KQRGFRFRYV CEGPSHGGLP GASSEKNKKS YPQVKICNYV GPAKVIVQLV TNGKNIHLHA HSLVGKHCED GICTVTAGPK DMVVGFANLG ILHVTKKKVF ETLEARMTEA CIRGYNPGLL VHPDLAYLQA EGGGDRQLGD REKELIRQAA LQQTKEMDLS VVRLMFTAFL PDSTGSFTRR LEPVVSDAIY DSKAPNASNL KIVRMDRTAG CVTGGEEIYL LCDKVQKDDI QIRFYEEEEN GGVWEGFGDF SPTDVHRQFA IVFKTPKYKD INITKPASVF VQLRRKSDLE TSEPKPFLYY PEIKDKEEVQ RKRQKLM
Specificity It has been selected for its ability to recognize NFkB in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant NFkB expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against NFkB.
Isotype IgG

Target Details NFKB1

Product Details anti-NFKB1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Nuclear Factor Kappa B (NFkB) (NFKB1 Antibody Abstract)
Pathways NF-kappaB Signaling, RTK Signaling, TCR Signaling, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-NFKB1 Antibody Target Details NFKB1 Handling Images back to top
Application Notes Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
Comment

Content: The quality control contains recombinant NFkB (Pro42~Met367) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions For Research Use only

Handling

Product Details anti-NFKB1 Antibody Target Details NFKB1 Application Details Images back to top
Format Liquid
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-NFKB1 Antibody Target Details NFKB1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-NFKB1 antibody (Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells 1) (AA 42-367) (ABIN1078409) anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells 1 (NFKB1) (AA 42-367) antibody