anti-Human TNFRSF1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TNFRSF1B Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibodies
  • MGC83471
  • LOC100218184
  • TRAF2
  • TANK
  • TNF-RII/TNFRSF1B
  • TNFRSF1B
  • CD120b
  • TBPII
  • TNF-R-II
  • TNF-R75
  • TNFBR
  • TNFR1B
  • TNFR2
  • TNFR80
  • p75
  • p75TNFR
  • TNF-R2
  • TNF-alphaR2
  • TNFRII
  • TNFalpha-R2
  • Tnfr-1
  • Tnfr2
  • TNFR-II
  • TNF receptor-associated factor 2
  • TNF receptor-associated factor 6, E3 ubiquitin protein ligase
  • TNF receptor-associated factor 3
  • TRAF family member-associated NFKB activator
  • tumor necrosis factor receptor superfamily, member 1B
  • tumor necrosis factor receptor superfamily, member 1b
  • TRAF2
  • traf2
  • TRAF6
  • LOC100218184
  • LOC100359083
  • TANK
  • TNFRSF1B
  • LOC100222629
  • Tnfrsf1b
Reactivity
Human
188
135
52
6
3
2
2
2
2
2
2
Host
Rabbit
126
91
24
20
16
13
1
Clonality
Polyclonal
Conjugate
This TNFRSF1B antibody is un-conjugated
29
14
10
6
6
6
5
4
4
4
4
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
162
113
95
55
55
43
27
27
19
18
9
7
7
7
3
3
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4360878
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.36902 ABIN784080 IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal
13.36902 ABIN1105803 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN111940 FACS IHC (fro) IHC (p) IP WB Mouse IgG1 Log in to see utr1 7
1 ABIN3044354 IHC (p) WB Rabbit IgG AA 103-121, Middle Region Log in to see Polyclonal
1 ABIN373981 IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal
1 ABIN625943 IHC (p) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1495139 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN1686907 IHC (p) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1104727 IHC (p) Neut ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1686906 IHC (p) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN380021 IHC (p) Biotin Mouse Log in to see utr 1
1 ABIN1740188 IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1740187 IHC (p) Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1495155 IHC (p) IP WB Sepharose Rabbit N-Term Log in to see Polyclonal
1 ABIN1495154 IHC (p) IP WB Magnetic Particles Rabbit N-Term Log in to see Polyclonal
1 ABIN221051 IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2629431 ICC IF IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal
1 ABIN602495 Func IHC (fro) IHC (p) ELISA WB Mouse IgG2a Log in to see
1 ABIN4360876 IHC IHC (p) Rabbit C-Term Log in to see Polyclonal
1 ABIN4360875 IHC IHC (p) Rabbit C-Term Log in to see Polyclonal

Top referenced anti-TNFRSF1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-TNFRSF1B Antibodies

Application / Reactivity Human
Agonist (Agon) 1 Antibodies
Blocking Antibody (Inhibition) 2 Antibodies
Cell Culture (CC) 2 Antibodies
ELISA 50 Antibodies
Enzyme Immunoassay (EIA) 13 Antibodies
Flow Cytometry (FACS) 60 Antibodies
Functional Studies (Func) 18 Antibodies
Immunoassay (IA) 5 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 18 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies
Immunohistochemistry (IHC) 47 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 35 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 25 Antibodies
Immunoprecipitation (IP) 33 Antibodies
Neutralization (Neut) 4 Antibodies

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibodies
Reactivity Human
(188), (135), (52), (6), (3), (2), (2), (2), (2), (2), (2)
Host Rabbit
(126), (91), (24), (20), (16), (13), (1)
Clonality
Polyclonal
Conjugate This TNFRSF1B antibody is un-conjugated
(29), (14), (10), (6), (6), (6), (5), (4), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(162), (113), (95), (55), (55), (43), (27), (27), (19), (18), (9), (7), (7), (7), (3), (3), (2), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-TNFRSF1B Antibody

Target Details TNFRSF1B Application Details Handling ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV
Isotype IgG

Target Details TNFRSF1B

Product Details anti-TNFRSF1B Antibody Application Details Handling ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Antigen
Alternative Name TNF RII/TNFRSF1B (TNFRSF1B Antibody Abstract)
Background Gene Symbol: TNFRSF1B
Gene ID 7133
Pathways NF-kappaB Signaling, Apoptosis, Cellular Response to Molecule of Bacterial Origin, Hepatitis C

Application Details

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Handling ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878)

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details Handling Images back to top
Product cited in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Images

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details Handling ProductDetails: References for anti-TNFRSF1B antibody (ABIN4360878) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-TNFRSF1B antibody (Tumor Necrosis Factor Receptor Superfamily, Member 1B) (ABIN4360878) Immunohistochemistry-Paraffin: TNF RII/TNFRSF1B Antibody - Staining of human stomach...
Western Blotting (WB) image for anti-TNFRSF1B antibody (Tumor Necrosis Factor Receptor Superfamily, Member 1B) (ABIN4360878) Western Blot: TNF RII/TNFRSF1B Antibody - Analysis in human cell line CAPAN-2.