anti-Rat (Rattus) CHEK2 antibody for Western Blotting

Recommended CHEK2 Antibody (supplied by: Log in to see )

Antigen
Checkpoint Kinase 2 (CHEK2) Antibodies
  • CDS1
  • CHK2
  • HuCds1
  • LFS2
  • PP1425
  • RAD53
  • hCds1
  • fa66f08
  • wu:fa66f08
  • zgc:55865
  • Cds1
  • HUCDS1
  • Rad53
  • Chk2
  • CHK-2
  • checkpoint kinase 2
  • CHK2 checkpoint homolog (S. pombe)
  • serine/threonine-protein kinase chk2
  • blue sensitive cone opsin
  • CHEK2
  • chek2
  • Chek2
  • MCYG_07308
  • LOC396525
Epitope
AA 465-498, C-Term
52
51
39
36
18
17
15
15
15
13
12
10
8
8
7
5
4
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
487
218
198
19
19
16
13
8
5
4
2
1
1
1
1
1
1
Host
Rabbit
352
136
8
1
1
Clonality
Polyclonal
Conjugate
This CHEK2 antibody is un-conjugated
10
9
9
7
7
5
5
5
5
5
5
5
5
5
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
399
126
124
106
90
66
48
43
27
6
6
5
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043811
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
2.9476938 ABIN968596 IF WB Mouse IgG1 AA 31-234 Log in to see 19-Chk2 2
2.9476938 ABIN968597 IF WB Mouse IgG1 AA 31-234 Log in to see 19-Chk2 2
2.9476938 ABIN408359 IHC (p) IHC WB Rabbit pThr68 Log in to see Polyclonal 7
2.9476938 ABIN3044245 WB Rabbit IgG AA 133-148, N-Term Log in to see Polyclonal
2.9476938 ABIN3043703 WB Rabbit IgG AA 427-441, C-Term Log in to see Polyclonal
2.9476938 ABIN1531803 IHC ELISA WB Rabbit IgG pThr68 Log in to see Polyclonal
2.9476938 ABIN1531263 IHC ELISA WB Rabbit IgG pThr387 Log in to see Polyclonal
2.9476938 ABIN1531498 IF ELISA WB Rabbit IgG pThr383 Log in to see Polyclonal
2.9476938 ABIN3182426 ELISA IF WB Rabbit IgG pThr383 Log in to see Polyclonal
2.9476938 ABIN3181964 ELISA IHC WB Rabbit IgG pThr68 Log in to see Polyclonal
2.9476938 ABIN3182510 ELISA IHC WB Rabbit IgG pThr387 Log in to see Polyclonal
2.9476938 ABIN3183906 ELISA IHC WB Rabbit IgG Tyr599 Log in to see Polyclonal
2.9476938 ABIN3183907 ELISA IHC WB Rabbit IgG Tyr60 Log in to see Polyclonal
2.9476938 ABIN3183904 ELISA IHC WB Rabbit IgG Tyr594 Log in to see Polyclonal
2.9476938 ABIN1532512 ELISA WB Rabbit IgG Log in to see Polyclonal
2.9476938 ABIN1532833 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
2.9476938 ABIN1532281 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
2.9476938 ABIN1106683 WB Rabbit IgG C-Term Log in to see Polyclonal
2.9476938 ABIN223048 IF WB Rabbit IgG N-Term Log in to see Polyclonal
2.9476938 ABIN2705870 IHC WB Rabbit pSer387 Log in to see Polyclonal

General

Antigen Checkpoint Kinase 2 (CHEK2) Antibodies
Epitope AA 465-498, C-Term
(52), (51), (39), (36), (18), (17), (15), (15), (15), (13), (12), (10), (8), (8), (7), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(487), (218), (198), (19), (19), (16), (13), (8), (5), (4), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(352), (136), (8), (1), (1)
Clonality
Polyclonal
Conjugate This CHEK2 antibody is un-conjugated
(10), (9), (9), (7), (7), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(399), (126), (124), (106), (90), (66), (48), (43), (27), (6), (6), (5), (2), (1), (1)
Supplier Log in to see

Product Details anti-CHEK2 Antibody

Target Details CHEK2 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence KLLVVDPKAR FTTEEALRHP WLQDEDMKRK FQDL
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.
Isotype IgG

Target Details CHEK2

Product Details anti-CHEK2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CHEK2 (CHEK2 Antibody Abstract)
Background CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.

Synonyms: bA444G7 antibody|CDS 1 antibody|CDS1 antibody|Checkpoint kinase 2 antibody|Checkpoint like protein CHK2 antibody|Chek 2 antibody|Chek2 antibody|Chk 2 antibody|CHK2 checkpoint homolog (S. pombe) antibody|CHK2 checkpoint homolog antibody|CHK2_HUMAN antibody|HuCds 1 antibody| HuCds1 antibody|LFS 2 antibody|LFS2 antibody|PP1425 antibody|RAD 53 antibody|RAD53 antibody|Rad53 homolog antibody|Serine/threonine protein kinase Chk2 antibody| Serine/ threonine-protein kinase Chk2 antibody
Gene ID 11200
UniProt O96017
Pathways p53 Signaling, Apoptosis, Cell Division Cycle

Application Details

Product Details anti-CHEK2 Antibody Target Details CHEK2 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-CHEK2 Antibody Target Details CHEK2 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-CHEK2 Antibody Target Details CHEK2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (Image 2)