You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) HRAS antibody for Western Blotting

Recommended HRAS Antibody (supplied by: Log in to see )

V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) Antibodies
  • H-Ras
  • K-Ras
  • hras1
  • rash1
  • HRAS
  • ras
  • N-Ras
  • c-bas/has
  • hras
  • zgc:110250
  • H-RAS
  • C-H-RAS
  • C-HA-RAS1
  • CTLO
  • HRAS1
  • K-RAS
  • N-RAS
  • RASH1
  • c-H-ras
  • H-ras
  • Ha-ras
  • Harvey-ras
  • Hras-1
  • Kras2
  • c-Ha-ras
  • c-rasHa
  • AI929937
  • K-ras
  • Ki-ras
  • Kras-2
  • p21B
  • Harvey rat sarcoma viral oncogene homolog
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog a
  • neuroblastoma RAS viral (v-ras) oncogene homolog
  • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
  • Harvey rat sarcoma virus oncogene
  • Harvey rat sarcoma virus oncogene 1
  • hras
  • HRAS
  • hrasa
  • NRAS
  • KRAS
  • Hras
  • Hras1
  • Kras
AA 101-137, C-Term
Mouse (Murine), Rat (Rattus)
This HRAS antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043845
$ 200.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0920615 ABIN407809 IHC (p) IHC WB Rabbit Log in to see Polyclonal
3.0920615 ABIN4319843 ICC IF IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
3.0920615 ABIN2431043 ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1498713 IF IHC (p) WB Mouse IgG2b Log in to see 1C2
1 ABIN1498715 IF IHC (p) WB Mouse IgG1 Log in to see 1A1
1 ABIN5518760 WB Rabbit IgG AA 111-137, C-Term Log in to see Polyclonal
1 ABIN1498714 IF IHC (p) WB Mouse IgG1 Log in to see 1D9
1 ABIN737226 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN224929 IHC (fro) IF IHC (p) IP Neut WB Rat IgG1, kappa AA 62-76 Log in to see
1 ABIN2622045 WB Mouse IgG1 Log in to see 1H3
1 ABIN2606862 ELISA WB FITC Rabbit IgG Log in to see Polyclonal
1 ABIN2606859 ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2606860 ELISA WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1584571 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN763385 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1992486 ELISA WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1992484 ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN1992485 ELISA WB FITC Rabbit IgG Log in to see Polyclonal
1 ABIN2467939 WB Chicken AA 116-189 Log in to see Polyclonal
1 ABIN2963063 ICC IHC (p) WB Rabbit AA 111-189 Log in to see Polyclonal

Similar anti-HRAS Antibodies

Application / Reactivity Mouse (Murine) Rat (Rattus)
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Western Blotting (WB) 49 Antibodies 40 Antibodies
Neutralization (Neut) 1 Antibodies 1 Antibodies
Immunoprecipitation (IP) 3 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies 14 Antibodies
Immunohistochemistry (IHC) 10 Antibodies 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 26 Antibodies 26 Antibodies
Immunofluorescence (IF) 13 Antibodies 8 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 3 Antibodies


Antigen V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) Antibodies
Epitope AA 101-137, C-Term
(11), (9), (5), (5), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine), Rat (Rattus)
(114), (80), (70), (11), (10), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(101), (30), (1), (1)
Conjugate This HRAS antibody is un-conjugated
(7), (6), (6), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Western Blotting (WB)
(93), (42), (26), (24), (20), (18), (5), (4), (3), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-HRAS Antibody

Target Details HRAS Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
Cross-Reactivity (Details) Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
Characteristics Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Harvey rat sarcoma viral oncogene homolog
Protein Name: GTPase Hras
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
Isotype IgG

Target Details HRAS

Product Details anti-HRAS Antibody Application Details Handling Images back to top
Alternative Name HRAS (HRAS Antibody Abstract)
Background GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

Synonyms: C BAS/HAS antibody|c H ras antibody|C HA RAS1 antibody|c has/bas p21 protein antibody|c ras Ki 2 activated oncogene antibody|c-H-ras antibody|CTLO antibody|GTP and GDP binding peptide B antibody|GTPase HRas, N-terminally processed antibody|H Ras 1 antibody|H RASIDX antibody|H-Ras-1 antibody|Ha Ras antibody|Ha Ras1 proto oncoprotein antibody|Ha-Ras antibody|HAMSV antibody|Harvey rat sarcoma viral oncogene homolog antibody|Harvey rat sarcoma viral oncoprotein antibody|HRAS antibody|HRAS1 antibody|K ras antibody|N ras antibody|p19 H RasIDX protein antibody|p21ras antibody|Ras family small GTP binding protein H Ras antibody|RASH_HUMAN antibody|RASH1 antibody| Transformation gene oncogene HAMSV antibody|Transforming protein p21 antibody|v Ha ras Harvey rat sarcoma viral oncogene homolog antibody|VH Ras antibody|vHa RAS antibody
Gene ID 3265
UniProt P01112
Pathways p53 Signaling, MAPK Signaling, RTK Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-HRAS Antibody Target Details HRAS Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only


Product Details anti-HRAS Antibody Target Details HRAS Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-HRAS Antibody Target Details HRAS Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-HRAS antibody (V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog) (AA 101-137) (ABIN3043845) anti-V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) (AA 101-137), (C-Term) antibody