You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) HRAS antibody for Western Blotting

Recommended HRAS Antibody (supplied by: Log in to see )

Antigen
V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) Antibodies
  • AI929937
  • c-bas/has
  • C-BAS/HAS
  • C-H-RAS
  • c-H-ras
  • c-Ha-ras
  • C-HA-RAS1
  • c-rasHa
  • CTLO
  • H-RAS
  • H-Ras
  • H-ras
  • H-RASIDX
  • Ha-ras
  • HAMSV
  • Harvey-ras
  • HRAS
  • hras
  • Hras-1
  • HRAS1
  • hras1
  • K-ras
  • K-Ras
  • K-RAS
  • Ki-ras
  • Kras-2
  • Kras2
  • N-RAS
  • N-Ras
  • p21B
  • ras
  • rash1
  • RASH1
  • zgc:110250
Epitope
AA 101-137, C-Term
17
8
5
5
4
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Mouse (Murine), Rat (Rattus)
107
58
53
5
4
2
Host
Rabbit
93
30
2
1
Clonality
Polyclonal
Conjugate
This HRAS antibody is un-conjugated
7
6
6
2
2
2
2
2
2
2
2
2
1
1
1
Application
Western Blotting (WB)
89
42
27
22
18
16
5
4
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043845
$ 200.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.12303223 ABIN189394 ICC FACS IF IHC (p) IP IHC WB Rabbit IgG C-Term Log in to see Y132
0.12303223 ABIN2440517 ICC IF IHC (fp) WB Rabbit IgG Log in to see Polyclonal
0.12303223 ABIN2431043 ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1584571 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0011806369 ABIN763378 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN763385 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN737228 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN737235 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN407809 IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN2467939 WB Chicken AA 116-189 Log in to see Polyclonal
0.0011806369 ABIN1992484 ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1992486 ELISA WB HRP Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1992485 ELISA WB FITC Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN763376 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN737226 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1094499 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1094498 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN1992483 ELISA WB Rabbit IgG Log in to see Polyclonal
0.0011806369 ABIN2861130 ELISA WB Rabbit C-Term Log in to see Polyclonal
0.0011806369 ABIN2606859 ELISA WB Biotin Rabbit IgG Log in to see Polyclonal

Similar anti-HRAS Antibodies

Application / Reactivity Mouse (Murine) Rat (Rattus)
Western Blotting (WB) 35 Antibodies 30 Antibodies
Immunoprecipitation (IP) 3 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies 9 Antibodies
Immunohistochemistry (IHC) 10 Antibodies 8 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 22 Antibodies 22 Antibodies
Immunofluorescence (IF) 8 Antibodies 5 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 3 Antibodies
Flow Cytometry (FACS) 1 Antibodies 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
ELISA 19 Antibodies

General

Antigen V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) Antibodies
Epitope AA 101-137, C-Term
(17), (8), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine), Rat (Rattus)
(107), (58), (53), (5), (4), (2)
Host Rabbit
(93), (30), (2), (1)
Clonality
Polyclonal
Conjugate This HRAS antibody is un-conjugated
(7), (6), (6), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Western Blotting (WB)
(89), (42), (27), (22), (18), (16), (5), (4), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-HRAS Antibody

Target Details HRAS Application Details Handling Images
Sequence KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLAR
Cross-Reactivity (Details) Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
Characteristics Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Harvey rat sarcoma viral oncogene homolog
Protein Name: GTPase Hras
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
Isotype IgG

Target Details HRAS

Product Details anti-HRAS Antibody Application Details Handling Images back to top
Antigen
Alternative Name HRAS (HRAS Antibody Abstract)
Background GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
Gene ID 3265
UniProt P01112
Pathways p53 Signaling, MAPK Signaling, RTK Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-HRAS Antibody Target Details HRAS Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only

Handling

Product Details anti-HRAS Antibody Target Details HRAS Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C,4 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-HRAS Antibody Target Details HRAS Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-HRAS antibody (V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog) (AA 101-137) (ABIN3043845) anti-V-Ha-Ras Harvey Rat Sarcoma Viral Oncogene Homolog (HRAS) (AA 101-137), (C-Term) antibody