You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) PDCD6IP antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PDCD6IP Antibody (supplied by: Log in to see )

Antigen
Programmed Cell Death 6 Interacting Protein (PDCD6IP) Antibodies
  • AIP1
  • ALIX
  • Aip1
  • Alix
  • CG12876
  • DAIP1
  • Dmel\\CG12876
  • GB11744
  • DDBDRAFT_0167145
  • DDBDRAFT_0185177
  • DDB_0167145
  • DDB_0185177
  • zgc:63638
  • wu:fb70d03
  • wu:fy65h02
  • PDCD6IP
  • aip1
  • alix
  • hp95
  • drip4
  • 2310011D08Rik
  • AI480459
  • mKIAA1743
  • DRIP4
  • HP95
  • AI480591
  • AW544830
  • C76364
  • Eig2
  • mKIAA1375
  • RGD1561176
  • NORI-1
  • ALG-2 interacting protein X
  • programmed cell death 6 interacting protein
  • Programmed cell death 6 interacting protein
  • disabled 2 interacting protein
  • WD repeat domain 1
  • ALiX
  • alxA
  • pdcd6ip
  • PDCD6IP
  • Bm1_48390
  • Dab2ip
  • Pdcd6ip
  • WDR1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
105
47
45
19
2
Host
Rabbit
57
42
10
1
Clonality
Polyclonal
Conjugate
This PDCD6IP antibody is un-conjugated
5
4
4
4
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
77
55
43
26
23
19
17
11
3
3
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4279376
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN181090 EIA IF IHC (p) IP WB Mouse IgG1 Log in to see 3A9 1
1 ABIN260230 ICC IF IHC (p) IP IHC ELISA WB Mouse IgG1 Log in to see 3A9
1 ABIN2477348 IF IHC (p) IP ELISA WB Mouse IgG1 Log in to see 3A9 4
1 ABIN609143 IF IHC (p) IP ELISA WB Mouse IgG1 Log in to see
1 ABIN4279372 ELISA ICC IF IHC IHC (p) IP WB Mouse IgG1 Log in to see 3A9
1 ABIN4279386 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see 3A9
1 ABIN4279387 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 Log in to see 3A9
1 ABIN4279388 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 Log in to see 3A9
1 ABIN4279389 ELISA ICC IF IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 Log in to see 3A9
1 ABIN4279385 ELISA ICC IF IHC IHC (p) WB DyLight 680 Mouse IgG1 Log in to see 3A9
1 ABIN4279383 ELISA ICC IF IHC IHC (p) WB DyLight 488 Mouse IgG1 Log in to see 3A9
1 ABIN4279382 ELISA ICC IF IHC IHC (p) WB DyLight 755 Mouse IgG1 Log in to see 3A9
1 ABIN4279380 ELISA ICC IF IHC IHC (p) IP WB PerCP Mouse IgG1 Log in to see 3A9
1 ABIN4279377 ELISA ICC IF IHC IHC (p) WB DyLight 350 Mouse IgG1 Log in to see 3A9
1 ABIN4279378 ELISA ICC IF IHC IHC (p) WB DyLight 405 Mouse IgG1 Log in to see 3A9
1 ABIN1410746 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN206627 IF IHC (p) IP ELISA WB Mouse IgG1 Log in to see
1 ABIN4279391 ELISA IHC IHC (p) WB HRP Mouse IgG1 Log in to see 3A9
1 ABIN1392853 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN4279379 ELISA ICC IF IHC IHC (p) IP WB PE Mouse IgG1 Log in to see 3A9

Top referenced anti-PDCD6IP antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PDCD6IP Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 21 Antibodies 21 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies
Immunocytochemistry (ICC) 17 Antibodies 17 Antibodies
Immunofluorescence (IF) 28 Antibodies 30 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies 11 Antibodies
Immunohistochemistry (IHC) 18 Antibodies 17 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 24 Antibodies 24 Antibodies
Immunoprecipitation (IP) 12 Antibodies 12 Antibodies
Western Blotting (WB) 34 Antibodies 33 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Intracellular Flow Cytometry (ICFC) 1 Antibodies

General

Antigen Programmed Cell Death 6 Interacting Protein (PDCD6IP) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(105), (47), (45), (19), (2)
Host Rabbit
(57), (42), (10), (1)
Clonality
Polyclonal
Conjugate This PDCD6IP antibody is un-conjugated
(5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(77), (55), (43), (26), (23), (19), (17), (11), (3), (3), (3), (1), (1)
Supplier Log in to see

Product Details anti-PDCD6IP Antibody

Target Details PDCD6IP Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND
Isotype IgG

Target Details PDCD6IP

Product Details anti-PDCD6IP Antibody Application Details Handling Images back to top
Antigen
Alternative Name Alix (PDCD6IP Antibody Abstract)
Background Gene Symbol: PDCD6IP
Gene ID 10015
Pathways p53 Signaling, EGFR Signaling Pathway

Application Details

Product Details anti-PDCD6IP Antibody Target Details PDCD6IP Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PDCD6IP Antibody Target Details PDCD6IP Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PDCD6IP Antibody Target Details PDCD6IP Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PDCD6IP antibody (Programmed Cell Death 6 Interacting Protein) (ABIN4279376) Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human stomach...
Western Blotting (WB) image for anti-PDCD6IP antibody (Programmed Cell Death 6 Interacting Protein) (ABIN4279376) Western Blot: Alix Antibody [NBP1-90201] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunofluorescence (IF) image for anti-PDCD6IP antibody (Programmed Cell Death 6 Interacting Protein) (ABIN4279376) Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of huma...
Western Blotting (WB) image for anti-PDCD6IP antibody (Programmed Cell Death 6 Interacting Protein) (ABIN4279376) Western Blot: Alix Antibody [NBP1-90201] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...