You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PML antibody for Immunofluorescence

Recommended PML Antibody (supplied by: Log in to see )

Antigen
Promyelocytic Leukemia (PML) Antibodies
  • PML
  • MYL
  • PP8675
  • RNF71
  • TRIM19
  • 1200009E24Rik
  • AI661194
  • Trim19
  • RGD1562602
  • promyelocytic leukemia
  • PML
  • Pml
Reactivity
Human
111
29
11
1
1
1
1
Host
Rabbit
89
39
Clonality
Polyclonal
Conjugate
This PML antibody is un-conjugated
5
5
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
113
46
41
39
25
22
17
6
5
5
4
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4346484
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.318237 ABIN1533381 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
11.318237 ABIN2707709 IC IF IHC WB Rabbit N-Term Log in to see Polyclonal
11.318237 ABIN1874171 IF IHC WB Rabbit IgG Log in to see Polyclonal
11.318237 ABIN3032330 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 470-499, Sumoylation Site Log in to see Polyclonal
11.318237 ABIN518988 IF ELISA WB Mouse IgG1 kappa AA 411-510, partial Log in to see 2B10
11.318237 ABIN562289 IF PLA ELISA WB Mouse IgG2a kappa AA 411-510, partial Log in to see 1D12
11.318237 ABIN2404038 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN389073 FACS IF IHC (p) WB Rabbit Ig AA 470-499, pSumoylation Site Log in to see Polyclonal 2
1 ABIN394032 IF WB Mouse IgG2a kappa AA 411-510 Log in to see 1D12 5
1 ABIN252967 ICC IF IHC (p) IP IHC PLA WB Rabbit AA 375-425 Log in to see Polyclonal 21
1 ABIN252968 ICC IF IHC IP WB Rabbit AA 575-625 Log in to see Polyclonal 2
1 ABIN271787 IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN3186510 ELISA IF IHC WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2889250 IF IHC (p) ELISA WB Rabbit IgG AA 11-60 Log in to see Polyclonal
1 ABIN2891555 IF IHC (p) WB Rabbit Pro39 Log in to see Polyclonal
1 ABIN1828620 IF ELISA WB Mouse IgG2a, kappa AA 411-510 Log in to see 1D12
1 ABIN2476174 IF WB Mouse IgG2a AA 411-510 Log in to see 1D12
1 ABIN2581137 IF ELISA WB Mouse IgG2a AA 411-510 Log in to see
1 ABIN2581142 ICC IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2699847 IF IHC WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-PML antibody for Immunofluorescence

Similar anti-PML Antibodies

Application / Reactivity Human
Dot Blot (DB) 3 Antibodies
ELISA 44 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 5 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 18 Antibodies
Immunofluorescence (IF) 36 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies
Immunohistochemistry (IHC) 39 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 23 Antibodies
Immunoprecipitation (IP) 10 Antibodies
Proximity Ligation Assay (PLA) 4 Antibodies
Western Blotting (WB) 97 Antibodies

General

Antigen Promyelocytic Leukemia (PML) Antibodies
Reactivity Human
(111), (29), (11), (1), (1), (1), (1)
Host Rabbit
(89), (39)
Clonality
Polyclonal
Conjugate This PML antibody is un-conjugated
(5), (5), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(113), (46), (41), (39), (25), (22), (17), (6), (5), (5), (4), (3), (2), (2), (1), (1), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-PML Antibody

Target Details PML Application Details Handling References for anti-PML Antibody (ABIN4346484) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP
Isotype IgG

Target Details PML

Product Details anti-PML Antibody Application Details Handling References for anti-PML Antibody (ABIN4346484) Images back to top
Antigen
Alternative Name PML Protein (PML Antibody Abstract)
Background Gene Symbol: PML
Gene ID 5371
Research Area Transcription Factors, Cancer
Pathways p53 Signaling, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus

Application Details

Product Details anti-PML Antibody Target Details PML Handling References for anti-PML Antibody (ABIN4346484) Images back to top
Application Notes Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID 28095508).
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PML Antibody Target Details PML Application Details References for anti-PML Antibody (ABIN4346484) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PML Antibody (ABIN4346484)

Product Details anti-PML Antibody Target Details PML Application Details Handling Images back to top
Product cited in:

Niu, Livingston, Li, Beran, Daffis, Ramakrishnan, Burdette, Peiser, Salas, Ramos, Yu, Cheng, Strubin, Delaney Iv, Fletcher: "The Smc5/6 Complex Restricts HBV when Localized to ND10 without Inducing an Innate Immune Response and Is Counteracted by the HBV X Protein Shortly after Infection." in: PLoS ONE, Vol. 12, Issue 1, pp. e0169648, 2017 Method employed by authors: Western Blotting (WB) (Sample species: Human).

Stepp, Meyers, McBride: "Sp100 provides intrinsic immunity against human papillomavirus infection." in: mBio, Vol. 4, Issue 6, pp. e00845-13, 2013

Campagna, Herranz, Garcia, Marcos-Villar, González-Santamaría, Gallego, Gutierrez, Collado, Serrano, Esteban, Rivas: "SIRT1 stabilizes PML promoting its sumoylation." in: Cell death and differentiation, Vol. 18, Issue 1, pp. 72-9, 2010

Images

Product Details anti-PML Antibody Target Details PML Application Details Handling References for anti-PML Antibody (ABIN4346484) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PML antibody (Promyelocytic Leukemia) (ABIN4346484) Immunohistochemistry-Paraffin: PML Protein Antibody [NBP1-87783] - Staining of human ...
Immunofluorescence (IF) image for anti-PML antibody (Promyelocytic Leukemia) (ABIN4346484) Immunocytochemistry/Immunofluorescence: PML Protein Antibody [NBP1-87783] - Staining ...