You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PPP1R13B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPP1R13B Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) Antibodies
  • pp2ca1
  • ppp1r13b
  • si:ch211-253p18.1
  • wu:fd42g12
  • zgc:153820
  • AI449786
  • ASPP1
  • AW545810
  • Tp53bp2
  • Trp53bp2
  • p85
  • p53BP2-like
  • protein phosphatase, Mg2+/Mn2+ dependent, 1Ab
  • protein phosphatase 1, regulatory (inhibitor) subunit 13B
  • protein phosphatase 1, regulatory (inhibitor) subunit 13Bb
  • protein phosphatase 1, regulatory subunit 13B
  • ppm1ab
  • PPP1R13B
  • ppp1r13b
  • Ppp1r13b
  • ppp1r13bb
Reactivity
Human, Mouse (Murine), Rat (Rattus)
58
28
27
2
2
1
1
1
1
1
1
1
Host
Rabbit
57
1
Clonality
Polyclonal
Conjugate
This PPP1R13B antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
44
22
13
6
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4281914
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN674388 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN674381 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN674379 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 1

Top referenced anti-PPP1R13B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PPP1R13B Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 3 Antibodies 3 Antibodies 22 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 1 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies 13 Antibodies
Immunohistochemistry (IHC) 3 Antibodies 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies 4 Antibodies
Western Blotting (WB) 15 Antibodies 16 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies

General

Antigen Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(58), (28), (27), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(57), (1)
Clonality
Polyclonal
Conjugate This PPP1R13B antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(44), (22), (13), (6), (3), (2), (1)
Supplier Log in to see

Product Details anti-PPP1R13B Antibody

Target Details PPP1R13B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNK
Isotype IgG

Target Details PPP1R13B

Product Details anti-PPP1R13B Antibody Application Details Handling Images back to top
Antigen
Alternative Name ASPP1 (PPP1R13B Antibody Abstract)
Background Gene Symbol: PPP1R13B
Gene ID 23368
Research Area Stem Cells
Pathways p53 Signaling

Application Details

Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PPP1R13B Antibody Target Details PPP1R13B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-PPP1R13B antibody (Protein Phosphatase 1, Regulatory Subunit 13B) (ABIN4281914) Immunocytochemistry/Immunofluorescence: ASPP1 Antibody [NBP1-90078] - Staining of hum...
Western Blotting (WB) image for anti-PPP1R13B antibody (Protein Phosphatase 1, Regulatory Subunit 13B) (ABIN4281914) Western Blot: ASPP1 Antibody [NBP1-90078] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PPP1R13B antibody (Protein Phosphatase 1, Regulatory Subunit 13B) (ABIN4281914) Immunohistochemistry-Paraffin: ASPP1 Antibody [NBP1-90078] - Staining of human cerebr...
Western Blotting (WB) image for anti-PPP1R13B antibody (Protein Phosphatase 1, Regulatory Subunit 13B) (ABIN4281914) Western Blot: ASPP1 Antibody [NBP1-90078] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...