You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human SCYL1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended SCYL1 Antibody (supplied by: Log in to see )

Antigen
SCY1-Like 1 (S. Cerevisiae) (SCYL1) Antibodies
  • 2810011O19Rik
  • C85140
  • DDBDRAFT_0189357
  • DDBDRAFT_0220502
  • DDB_0189357
  • DDB_0220502
  • GKLP
  • mdf
  • mfd
  • NKTL
  • Ntkl
  • NTKL
  • P105
  • p105
  • TAPK
  • TEIF
  • TRAP
Reactivity
Human, Mouse (Murine)
38
Host
Rabbit
28
10
Clonality
Polyclonal
Conjugate
This SCYL1 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
34
23
18
4
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4352324
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089185475 ABIN652299 IHC (p) WB Rabbit Ig AA 156-185, N-Term Log in to see Polyclonal

Similar anti-SCYL1 Antibodies

Application / Reactivity Mouse (Murine) Human
Immunocytochemistry (ICC) 1 Antibodies 3 Antibodies
Immunofluorescence (IF) 1 Antibodies 5 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 19 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 2 Antibodies
Western Blotting (WB) 1 Antibodies 35 Antibodies
ELISA 23 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunoprecipitation (IP) 2 Antibodies

General

Antigen SCY1-Like 1 (S. Cerevisiae) (SCYL1) Antibodies
Reactivity Human, Mouse (Murine)
(38)
Host Rabbit
(28), (10)
Clonality
Polyclonal
Conjugate This SCYL1 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(34), (23), (18), (4), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-SCYL1 Antibody

Target Details SCYL1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
Isotype IgG

Target Details SCYL1

Product Details anti-SCYL1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SCYL1 (SCYL1 Antibody Abstract)
Background Gene Symbol: SCYL1
Research Area Chromatin Binding Proteins, Transcription Factors, Chromatin and Nuclear Signaling
Pathways p53 Signaling

Application Details

Product Details anti-SCYL1 Antibody Target Details SCYL1 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SCYL1 Antibody Target Details SCYL1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SCYL1 Antibody Target Details SCYL1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SCYL1 antibody (SCY1-Like 1 (S. Cerevisiae)) (ABIN4352324) Immunohistochemistry-Paraffin: SCYL1 Antibody [NBP1-83365] - Staining of human pancre...
Western Blotting (WB) image for anti-SCYL1 antibody (SCY1-Like 1 (S. Cerevisiae)) (ABIN4352324) Western Blot: SCYL1 Antibody [NBP1-83365] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-SCYL1 antibody (SCY1-Like 1 (S. Cerevisiae)) (ABIN4352324) Western Blot: SCYL1 Antibody [NBP1-83365] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunofluorescence (IF) image for anti-SCYL1 antibody (SCY1-Like 1 (S. Cerevisiae)) (ABIN4352324) Immunocytochemistry/Immunofluorescence: SCYL1 Antibody [NBP1-83365] - Staining of hum...