You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human TWIST1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TWIST1 Antibody (supplied by: Log in to see )

Twist Homolog 1 (Drosophila) (TWIST1) Antibodies
  • scs
  • Xtwi
  • acs3
  • X-twi
  • bpes2
  • bpes3
  • twist
  • Xtwist
  • MGC69439
  • twist1
  • ACS3
  • BPES2
  • BPES3
  • CRS1
  • SCS
  • bHLHa38
  • AA960487
  • M-Twist
  • Pde
  • Ska10
  • Ska
  • Twist
  • pdt
  • cTwist
  • Twist1b
  • twist-1
  • wu:fd04c01
  • zgc:101115
  • twist homolog 1 (Drosophila)
  • twist homolog 1
  • twist basic helix-loop-helix transcription factor 1
  • twist1a
  • TWIST1
  • twist1
  • twist1-a
  • Twist1
  • twist1a
This TWIST1 antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN189738
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.693989 ABIN2179882 IF (p) IHC (p) WB Rabbit IgG AA 108-150 Log in to see Polyclonal
1 ABIN957823 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2179893 IHC (p) WB HRP Rabbit IgG AA 108-150 Log in to see Polyclonal
1 ABIN1823488 ICC FACS IHC (p) ELISA WB Mouse IgG1 AA 9-74 Log in to see 10E4E6
1 ABIN2179887 IHC (p) WB Biotin Rabbit IgG AA 108-150 Log in to see Polyclonal
1 ABIN4363579 CyTOF ELISA FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 10E4E6
1 ABIN4363580 CyTOF ELISA FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 10E4E6
1 ABIN2764778 IHC (p) WB Rabbit N-Term Log in to see Polyclonal

Top referenced anti-TWIST1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

  • Human Polyclonal TWIST1 Primary Antibody for IHC (p), IHC - ABIN189738 (1 Publications): Jin, Ren, Macarak, Rosenbloom et al.: Pathobiological mechanisms of peritoneal adhesions: The mesenchymal transition of rat peritoneal mesothelial cells induced by TGF-β1 and IL-6 requires activation of Erk1/2 and Smad2 linker region ... in Matrix biology : journal of the International Society for Matrix Biology 2016 (PubMed)

Similar anti-TWIST1 Antibodies

Application / Reactivity Human
Cytometry by Time of Flight (CyTOF) 2 Antibodies
Dot Blot (DB) 4 Antibodies
ELISA 47 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 24 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 12 Antibodies
Immunofluorescence (IF) 14 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 26 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 9 Antibodies
RNA Interference (RNAi) 2 Antibodies
Western Blotting (WB) 89 Antibodies


Antigen Twist Homolog 1 (Drosophila) (TWIST1) Antibodies
Reactivity Human
(120), (56), (52), (4), (4), (4), (4), (3), (2), (2), (2), (1), (1)
Host Rabbit
(63), (49), (10)
Conjugate This TWIST1 antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), Western Blotting (WB)
(90), (47), (25), (24), (14), (13), (12), (9), (8), (4), (2), (2), (2), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-TWIST1 Antibody

Target Details TWIST1 Application Details Handling References for anti-TWIST1 Antibody (ABIN189738) Images
Specificity TWIST1
Purification Protein A purified
Immunogen A synthetic peptide corresponding to a region of human TWIST1 with an internal ID of P20171. Peptide sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW.

Target Details TWIST1

Product Details anti-TWIST1 Antibody Application Details Handling References for anti-TWIST1 Antibody (ABIN189738) Images back to top
Alternative Name Twist-1 (TWIST1 Antibody Abstract)
Background Gene Symbol: TWIST1
Molecular Weight Theoretical MW: 21 kDa
Gene ID 7291
Pathways p53 Signaling, Proton Transport, Tube Formation

Application Details

Product Details anti-TWIST1 Antibody Target Details TWIST1 Handling References for anti-TWIST1 Antibody (ABIN189738) Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500WB: Use at a concentration of 2.5 The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-TWIST1 Antibody Target Details TWIST1 Application Details References for anti-TWIST1 Antibody (ABIN189738) Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage -80 °C,-20 °C
Storage Comment Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.

References for anti-TWIST1 Antibody (ABIN189738)

Product Details anti-TWIST1 Antibody Target Details TWIST1 Application Details Handling Images back to top
Product cited in:

Jin, Ren, Macarak, Rosenbloom et al.: "Pathobiological mechanisms of peritoneal adhesions: The mesenchymal transition of rat peritoneal mesothelial cells induced by TGF-β1 and IL-6 requires activation of Erk1/2 and Smad2 linker region ..." in: Matrix biology : journal of the International Society for Matrix Biology, Vol. 51, pp. 55-64, 2016 (Sample species: Rat (Rattus)). Further details: Western Blotting


Product Details anti-TWIST1 Antibody Target Details TWIST1 Application Details Handling References for anti-TWIST1 Antibody (ABIN189738) back to top
Supplier Images
Western Blotting (WB) image for anti-TWIST1 antibody (Twist Homolog 1 (Drosophila)) (ABIN189738) anti-Twist Homolog 1 (Drosophila) (TWIST1) antibody
Western Blotting (WB) image for anti-TWIST1 antibody (Twist Homolog 1 (Drosophila)) (ABIN189738) Western Blot: Twist-1 Antibody [ABIN1897384] - Jurkat cell lysate, Antibody Titration...
Western Blotting (WB) image for anti-TWIST1 antibody (Twist Homolog 1 (Drosophila)) (ABIN189738) Western Blot: Twist-1 Antibody [ABIN1897384] - Sample Tissue: Jurkat, Lane A: Primary...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-TWIST1 antibody (Twist Homolog 1 (Drosophila)) (ABIN189738) Immunohistochemistry-Paraffin: Twist-1 Antibody [ABIN1897384] - Human Uterus Tissue, ...