You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human HBXIP antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended HBXIP Antibody (supplied by: Log in to see )

Antigen
Hepatitis B Virus X-Interacting Protein (HBXIP) Antibodies
  • 1110003H18Rik
  • HBXIP
  • Hbxip
  • XIP
  • xip
Reactivity
Human
28
17
17
Host
Rabbit
24
4
Clonality
Polyclonal
Conjugate
This HBXIP antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
14
11
5
3
3
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4316655
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089185475 ABIN873319 IF (p) IHC (p) Rabbit IgG Log in to see Polyclonal
0.00089185475 ABIN900211 IHC (p) HRP Rabbit IgG Log in to see Polyclonal
0.00089185475 ABIN900217 IHC (p) Biotin Rabbit IgG Log in to see Polyclonal

Similar anti-HBXIP Antibodies

Application / Reactivity Human
ELISA 5 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Western Blotting (WB) 14 Antibodies

General

Antigen Hepatitis B Virus X-Interacting Protein (HBXIP) Antibodies
Reactivity Human
(28), (17), (17)
Host Rabbit
(24), (4)
Clonality
Polyclonal
Conjugate This HBXIP antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(14), (11), (5), (3), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-HBXIP Antibody

Target Details HBXIP Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD
Isotype IgG

Target Details HBXIP

Product Details anti-HBXIP Antibody Application Details Handling Images back to top
Antigen
Alternative Name HBXIP (HBXIP Antibody Abstract)
Background Gene Symbol: LAMTOR5
Research Area Immunology, Apoptosis/Necrosis
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-HBXIP Antibody Target Details HBXIP Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-HBXIP Antibody Target Details HBXIP Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-HBXIP Antibody Target Details HBXIP Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-HBXIP antibody (Hepatitis B Virus X-Interacting Protein) (ABIN4316655) Immunohistochemistry-Paraffin: HBXIP Antibody [NBP1-82664] - Immunohistochemical stai...
Immunofluorescence (IF) image for anti-HBXIP antibody (Hepatitis B Virus X-Interacting Protein) (ABIN4316655) Immunocytochemistry/Immunofluorescence: HBXIP Antibody [NBP1-82664] Staining of human...